Detailed information NTG0000417

Experimentally validated

Overview

• Name: comE/comE1
• Type: Regulator
• Locus tag: SGO_RS10500
• Genome accession: NC_009785
• Coordinates: 2191350..2192117 (-)
• Length: 255 a.a.
• NCBI ID: WP_008808031.1
• Uniprot ID: P75031
• Organism: Streptococcus gordonii str. Challis substr. CH1
• Function: activate transcription of early competence genes Competence regulation

Function

In S. gordonii, pre-CSP is a 50 aa polypeptide that is cleaved at a double glycine to generate the mature 19 aa residue CSP. This peptide is then exported out of the cell via an ABC-binding cassette transporter encoded by comA and comB. Once a critical concentration of environmental CSP is reached, it is detected by the two-component system ComDE, comprising a membrane-bound histidine kinase (ComD), which phosphorylates the intracellular response regulator ComE. ComE activates a signalling cascade that includes upregulation of the master regulator SigX (designated ComR in S. gordonii), an alternate sigma factor that controls expression of late competence genes encoding DNA uptake and recombination machinery.

Genomic Context

Location: 2186350..2197117

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SGO_RS10480 (SGO_2141)	pth	2189270..2189839 (-)	570	WP_012131076.1	aminoacyl-tRNA hydrolase	-
SGO_RS10485 (SGO_2142)	ychF	2189913..2191028 (-)	1116	WP_012131077.1	redox-regulated ATPase YchF	-
SGO_RS10500 (SGO_2145)	comE/comE1	2191350..2192117 (-)	768	WP_008808031.1	competence system response regulator transcription factor ComE	Regulator
SGO_RS10505 (SGO_2146)	comD/comD1	2192114..2193475 (-)	1362	WP_012131078.1	competence system sensor histidine kinase ComD	Regulator
SGO_RS10510 (SGO_2147)	comC/comC1	2193491..2193643 (-)	153	WP_012131079.1	bacteriocin	Regulator
SGO_RS10520 (SGO_2149)	rlmH	2193929..2194408 (-)	480	WP_012131080.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
SGO_RS10525 (SGO_2150)	htrA	2194602..2195795 (+)	1194	WP_012131081.1	S1C family serine protease	Regulator
SGO_RS10530 (SGO_2151)	spo0J	2195861..2196625 (+)	765	WP_012131082.1	ParB/RepB/Spo0J family partition protein	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comE/comE1	comA	positive effect
comA	comC/comC1	positive effect
comC/comC1	comD/comD1	positive effect
comD/comD1	comE/comE1	positive effect
comE/comE1	comC/comC1	positive effect
comB	comC/comC1	positive effect
comE/comE1	comB	positive effect
comE/comE1	comR/comR2	positive effect
comE/comE1	comE/comE1	positive effect
comE/comE1	comR/comR1	positive effect
comE/comE1	comD/comD1	positive effect
comR/comR2	late competence genes	positive effect
comR/comR2	late competence genes	positive effect
comR/comR1	late competence genes	positive effect
comR/comR1	late competence genes	positive effect

Sequence

Protein

• Length: 255 a.a.
• Molecular weight: 30225.48 Da
• Isoelectric Point: 7.0651

>NTDB_id=417 SGO_RS10500 WP_008808031.1 2191350..2192117(-) (comE/comE1) [Streptococcus gordonii str. Challis substr. CH1]
MKVLVLEDTIEHQVRIENVFEEISRELNLEIKAKVTGKIHEFKEYVESDEVNQLYFLDIDIKGEEQKGLEMAQFIRQHNP
YAIIVFVTSHSEFATLTFKYKVSALDFIDKDINDNSFKKRVKDCIVYTRNNLIENTDIVDFFEYSFRGNEIRIPFRDILY
IETTGSPYKLRVVGKNFFKEFYGTIAEIQEQDKELGYFFSPHKSYLSNISNISGYDKKTKDVLYYDGHRSPISRLRVRYL
KEILKAKSKKEENKK

Nucleotide

• Length: 768 bp

>NTDB_id=417 SGO_RS10500 WP_008808031.1 2191350..2192117(-) (comE/comE1) [Streptococcus gordonii str. Challis substr. CH1]
ATGAAAGTATTAGTGCTAGAAGATACTATTGAACATCAAGTGAGAATTGAAAATGTCTTCGAAGAAATTTCTCGCGAACT
TAATCTTGAAATTAAAGCAAAAGTAACAGGAAAAATTCATGAATTTAAAGAATATGTTGAGTCAGACGAGGTAAATCAAC
TTTATTTCTTAGATATAGATATTAAAGGAGAAGAACAAAAAGGTCTAGAAATGGCGCAATTTATACGCCAACATAATCCC
TATGCTATCATTGTTTTTGTCACGAGTCATTCAGAATTTGCGACTTTAACTTTTAAGTATAAAGTATCAGCGTTAGATTT
TATAGATAAAGACATAAATGATAATTCTTTTAAGAAAAGAGTTAAAGATTGCATCGTTTATACACGAAATAATTTAATTG
AAAATACAGATATTGTTGACTTTTTTGAGTATAGTTTTAGAGGAAACGAAATTCGAATTCCTTTTAGAGATATTCTATAT
ATTGAGACGACAGGAAGTCCTTATAAATTAAGAGTTGTTGGAAAAAATTTCTTTAAGGAATTTTATGGGACAATAGCAGA
AATTCAAGAACAAGATAAAGAACTTGGATATTTTTTCTCACCACATAAGTCATACCTATCTAATATTAGCAACATTAGTG
GATACGACAAAAAGACAAAAGATGTTTTATATTATGATGGTCATCGTTCACCGATTTCTCGATTACGTGTCAGATACTTG
AAAGAAATACTGAAAGCCAAAAGTAAAAAAGAAGAAAATAAAAAATAA

Domains

Predicted by InterproScan.

• LytTr DNA-binding domain (LytTR) (151-244)

• Response regulator receiver domain (Response_reg) (3-121)

3D structure

• AlphaFold DB: P75031

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE/comE2	Streptococcus gordonii strain NCTC7865	100	100	1
comE	Streptococcus mitis NCTC 12261	64	100	0.64
comE	Streptococcus infantis strain Atu-4	64	99.602	0.637
comE	Streptococcus mitis SK321	63.2	100	0.632
comE	Streptococcus pneumoniae R6	62.8	100	0.628
comE	Streptococcus pneumoniae D39	62.8	100	0.628
comE	Streptococcus pneumoniae Rx1	62.8	100	0.628
comE	Streptococcus pneumoniae TIGR4	62.8	100	0.628
comE/comE2	Streptococcus equinus JB1	36.255	100	0.373
comE/blpR	Streptococcus mutans UA159	37.551	98	0.368

References

• [1]: Alison A Jack et al. (2015) Streptococcus gordonii comCDE (competence) operon modulates biofilm formation with Candida albicans. Microbiology (Reading, England) 161(Pt 2):411-421. [PMID: 25505189]
• [2]: Nicholas C K Heng et al. (2007) Competence-dependent bacteriocin production by Streptococcus gordonii DL1 (Challis). Journal of Bacteriology 189(4):1468-72. [PMID: 17012395]
• [3]: R D Lunsford et al. (1996) Natural genetic transformation in Streptococcus gordonii: comX imparts spontaneous competence on strain wicky. Journal of Bacteriology 178(19):5831-5. [PMID: 8824638]
• [4]: L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047]