Detailed information NTG0000139

Experimentally validated

Overview

• Name: comE
• Type: Regulator
• Locus tag: SP_RS11425
• Genome accession: NC_003028
• Coordinates: 2155665..2156417 (-)
• Length: 250 a.a.
• NCBI ID: WP_000866065.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae TIGR4
• Function: activate transcription of early competence genes Competence regulation

Function

The comE gene encodes a response regulator that is phosphorylated by the histidine kinase ComD upon binding of the competence-stimulating peptide (CSP). ComE∼P is the active form of ComE, which recognizes and binds to a specific DNA motif, or ComE-box, upstream of early com genes and comX. By stimulating further transcription of early com genes, ComE∼P creates a positive amplification loop of the signal, which maintains the competent state for DNA uptake.

Genomic Context

Location: 2150665..2161417

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SP_RS13565	-	2153099..2154701 (-)	1603	Protein_2131	YhgE/Pip family protein	-
SP_RS11410 (SP_2234)	-	2154880..2155422 (+)	543	WP_001158266.1	TetR/AcrR family transcriptional regulator	-
SP_RS11425 (SP_2235)	comE	2155665..2156417 (-)	753	WP_000866065.1	competence system response regulator transcription factor ComE	Regulator
SP_RS11430 (SP_2236)	comD/comD2	2156414..2157739 (-)	1326	WP_000364845.1	competence system sensor histidine kinase ComD	Regulator
SP_RS11435 (SP_2237)	comC/comC2	2157760..2157885 (-)	126	WP_000799686.1	competence-stimulating peptide ComC	Regulator
SP_RS11445 (SP_2238)	rlmH	2158167..2158646 (-)	480	WP_000695929.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
SP_RS11450 (SP_2239)	htrA	2158829..2160010 (+)	1182	WP_000681597.1	S1C family serine protease	Regulator
SP_RS11455 (SP_2240)	spo0J	2160068..2160826 (+)	759	WP_000410378.1	ParB/RepB/Spo0J family partition protein	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comE	comE	positive effect
comE	comX/comX1	positive effect
comE	comW	positive effect
comE	comA	positive effect
comE	comB	positive effect
comE	comM	positive effect
comE	comX/comX2	positive effect
comE	comD/comD2	positive effect
comE	comC/comC2	positive effect
comD/comD2	comE	positive effect
stkP	comE	positive effect
comX/comX1	late competence genes	positive effect
clpP	comX/comX1	negative effect
comW	comX/comX1	positive effect
clpE	comX/comX1	negative effect
comW	comX/comX2	positive effect
clpP	comW	negative effect
mecA	comW	negative effect
clpC	comW	negative effect
comA	comC/comC2	positive effect
comB	comC/comC2	positive effect
comM	cbpD	negative effect
comX/comX2	late competence genes	positive effect
clpP	comX/comX2	negative effect
clpE	comX/comX2	negative effect
comC/comC2	comD/comD2	positive effect
ciaH	comC/comC2	negative effect
htrA	comC/comC2	negative effect
ciaR	comC/comC2	negative effect
comX/comX2	late competence genes	positive effect
comX/comX1	late competence genes	positive effect
cbpD	lytA	positive effect
cbpD	lytC	positive effect
ciaH	htrA	positive effect
htrA	comEC/celB	negative effect
htrA	comEA/celA/cilE	negative effect
ciaR	htrA	positive effect

Sequence

Protein

• Length: 250 a.a.
• Molecular weight: 29958.31 Da
• Isoelectric Point: 6.5073

>NTDB_id=139 SP_RS11425 WP_000866065.1 2155665..2156417(-) (comE) [Streptococcus pneumoniae TIGR4]
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLDIDIHGIEKKGFEVAQLIRHYNP
YAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILY
IETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKL
KDILEKKSQK

Nucleotide

• Length: 753 bp

>NTDB_id=139 SP_RS11425 WP_000866065.1 2155665..2156417(-) (comE) [Streptococcus pneumoniae TIGR4]
ATGAAAGTTTTAATTTTAGAAGATGTTATTGAACATCAAGTGAGACTAGAGAGAATATTGGATGAAATTTCGAAAGAATC
GAATATTCCAATATCATACAAGACAACGGGAAAAGTCCGTGAATTTGAAGAATACATTGAAAATGATGAAGTAAATCAGC
TTTATTTCCTAGATATCGATATTCATGGAATTGAGAAAAAGGGATTTGAAGTGGCTCAGCTCATTCGTCATTACAATCCT
TACGCTATTATCGTCTTTATCACTAGTCGATCAGAGTTTGCGACTCTAACCTATAAATACCAGGTATCAGCCCTAGATTT
TGTTGATAAGGATATCAATGATGAGATGTTTAAGAAGAGAATTGAGCAAAATATCTTCTACACGAAGAGTATGTTACTTG
AAAATGAAGATGTTGTAGATTATTTCGACTACAATTACAAGGGAAATGATTTAAAAATTCCTTACCATGATATTTTGTAT
ATTGAAACAACAGGGGTATCTCATAAATTGCGCATTATTGGTAAGAATTTTGCAAAAGAGTTTTATGGTACCATGACAGA
TATTCAGGAAAAGGACAAACATACTCAGCGATTTTATTCTCCTCACAAGTCATTTTTGGTAAATATAGGTAATATCAGAG
AAATTGATCGAAAAAACTTAGAAATTGTTTTCTATGAAGACCATCGTTGTCCTATTTCAAGATTAAAAATTAGAAAATTA
AAAGATATTTTAGAGAAAAAATCTCAAAAGTGA

Domains

Predicted by InterproScan.

• LytTr DNA-binding domain (LytTR) (151-244)

• Response regulator receiver domain (Response_reg) (3-121)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Streptococcus pneumoniae Rx1	100	100	1
comE	Streptococcus pneumoniae D39	100	100	1
comE	Streptococcus pneumoniae R6	100	100	1
comE	Streptococcus mitis SK321	99.2	100	0.992
comE	Streptococcus mitis NCTC 12261	98.4	100	0.984
comE	Streptococcus infantis strain Atu-4	91.2	100	0.912
comE/comE1	Streptococcus gordonii str. Challis substr. CH1	62.8	100	0.628
comE/comE2	Streptococcus gordonii strain NCTC7865	62.8	100	0.628
comE/blpR	Streptococcus mutans UA159	41.296	98.8	0.408
comE/comE2	Streptococcus equinus JB1	35.039	100	0.365

References

• [1]: Germán E Piñas et al. (2018) Crosstalk between the serine/threonine kinase StkP and the response regulator ComE controls the stress response and intracellular survival of Streptococcus pneumoniae. PLoS Pathogens 14(6):e1007118. [PMID: 29883472]
• [2]: Yuqiang Zheng et al. (2017) ComE, an Essential Response Regulator, Negatively Regulates the Expression of the Capsular Polysaccharide Locus and Attenuates the Bacterial Virulence in Streptococcus pneumoniae. Frontiers in Microbiology 8:277. [PMID: 28326061]
• [3]: Marion Boudes et al. (2014) Structural insights into the dimerization of the response regulator ComE from Streptococcus pneumoniae. Nucleic Acids Research 42(8):5302-13. [PMID: 24500202]
• [4]: Bernard Martin et al. (2013) ComE/ComE~P interplay dictates activation or extinction status of pneumococcal X-state (competence). Molecular Microbiology 87(2):394-411. [PMID: 23216914]
• [5]: Bernard Martin et al. (2010) Expression and maintenance of ComD-ComE, the two-component signal-transduction system that controls competence of Streptococcus pneumoniae. Molecular Microbiology 75(6):1513-28. [PMID: 20180906]
• [6]: Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980]
• [7]: O Ween et al. (1999) Identification of DNA binding sites for ComE, a key regulator of natural competence in Streptococcus pneumoniae. Molecular Microbiology 33(4):817-27. [PMID: 10447890]
• [8]: E V Pestova et al. (1996) Regulation of competence for genetic transformation in Streptococcus pneumoniae by an auto-induced peptide pheromone and a two-component regulatory system. Molecular Microbiology 21(4):853-62. [PMID: 8878046]
• [9]: L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047]