Detailed information    

experimental Experimentally validated

Overview


Name   ciaR   Type   Regulator
Locus tag   SP_RS03905 Genome accession   NC_003028
Coordinates   751962..752636 (+) Length   224 a.a.
NCBI ID   WP_000590640.1    Uniprot ID   D4I4V1
Organism   Streptococcus pneumoniae TIGR4     
Function   repress competence development; post-transcriptional repression of CSP production   
Competence regulation

Function


CiaRH negatively regulates competence development by controlling the expression of csRNAs (cia-dependent small RNAs) that target comC. These csRNAs post-transcriptionally regulate comC, thereby influencing the initiation of the competence cascade. A hyperactive CiaRH system might suppress competence development by increasing the level of HtrA at the outer surface of the cytoplasmic membrane.


Genomic Context


Location: 746962..757636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SP_RS03885 (SP_0794) - 747422..747922 (+) 501 WP_000403607.1 NUDIX hydrolase -
  SP_RS03890 (SP_0795) - 747900..748769 (+) 870 WP_001245833.1 putative PEP-binding protein -
  SP_RS03895 (SP_0796) - 748744..749184 (+) 441 WP_000612882.1 ASCH domain-containing protein -
  SP_RS03900 (SP_0797) - 749307..751853 (+) 2547 WP_001149111.1 M1 family metallopeptidase -
  SP_RS03905 (SP_0798) ciaR 751962..752636 (+) 675 WP_000590640.1 two-component system response regulator CiaR Regulator
  SP_RS03910 (SP_0799) ciaH 752626..753960 (+) 1335 WP_000491790.1 two-component system sensor histidine kinase CiaH Regulator
  SP_RS03915 (SP_0800) - 753994..754281 (-) 288 WP_001145225.1 DUF3270 domain-containing protein -
  SP_RS03920 (SP_0801) - 754421..755350 (+) 930 WP_000411859.1 peptidase U32 family protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  ciaR htrA positive effect
  htrA comC/comC2 negative effect
  comC/comC2 comD/comD2 positive effect
  comD/comD2 comE positive effect
  comE comE positive effect
  comE comX/comX1 positive effect
  comE comW positive effect
  comE comA positive effect
  comE comB positive effect
  comE comM positive effect
  comE comX/comX2 positive effect
  comE comD/comD2 positive effect
  comE comC/comC2 positive effect
  stkP comE positive effect
  comX/comX1 late competence genes positive effect
  clpP comX/comX1 negative effect
  comW comX/comX1 positive effect
  clpE comX/comX1 negative effect
  comW comX/comX2 positive effect
  clpP comW negative effect
  mecA comW negative effect
  clpC comW negative effect
  comA comC/comC2 positive effect
  comB comC/comC2 positive effect
  comM cbpD negative effect
  comX/comX2 late competence genes positive effect
  clpP comX/comX2 negative effect
  clpE comX/comX2 negative effect
  ciaH comC/comC2 negative effect
  ciaR comC/comC2 negative effect
  comX/comX2 late competence genes positive effect
  comX/comX1 late competence genes positive effect
  cbpD lytA positive effect
  cbpD lytC positive effect
  ciaH htrA positive effect
  htrA comEC/celB negative effect
  htrA comEA/celA/cilE negative effect

Sequence


Protein


Download         Length: 224 a.a.        Molecular weight: 25466.29 Da        Isoelectric Point: 4.3283

>NTDB_id=147 SP_RS03905 WP_000590640.1 751962..752636(+) (ciaR) [Streptococcus pneumoniae TIGR4]
MIKILLVEDDLGLSNSVFDFLDDFADVMQVFDGEEGLYEAESGVYDLILLDLMLPEKNGFQVLKELREKGITTPVLIMTA
KESLDDKGHGFELGADDYLTKPFYLEELKMRIQALLKRSGKFNENTLTYGNIVVNLSTNTVKVEDTPVELLGKEFDLLVY
FLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLKGTTFAENLQTLRSVGYLLKDVQ

Nucleotide


Download         Length: 675 bp        

>NTDB_id=147 SP_RS03905 WP_000590640.1 751962..752636(+) (ciaR) [Streptococcus pneumoniae TIGR4]
ATGATAAAAATCTTATTGGTTGAGGATGACCTAGGTCTGTCAAATTCAGTATTTGACTTTTTAGACGATTTTGCGGATGT
TATGCAGGTATTTGATGGAGAAGAAGGTCTCTACGAAGCTGAGAGTGGTGTCTATGACTTGATTTTGCTGGATTTGATGT
TGCCAGAAAAAAATGGTTTCCAAGTCTTAAAAGAATTGCGTGAAAAGGGAATTACGACACCAGTTCTGATTATGACTGCC
AAGGAAAGTTTGGATGACAAGGGACATGGATTTGAACTGGGAGCGGATGATTATCTGACCAAACCTTTCTACCTAGAAGA
ACTTAAAATGCGGATTCAGGCCCTTCTCAAACGTTCAGGGAAGTTTAATGAAAACACCTTGACTTATGGGAATATCGTGG
TTAATTTATCAACCAATACCGTTAAAGTTGAAGATACTCCTGTCGAATTGCTGGGGAAAGAGTTCGATTTACTAGTTTAT
TTCCTTCAAAATCAAAATGTGATTTTGCCTAAGACGCAGATTTTTGACCGTCTATGGGGATTTGATAGTGATACAACGAT
TTCGGTTGTCGAAGTCTATGTTTCAAAAGTCCGTAAGAAATTAAAGGGAACCACTTTTGCAGAGAATTTGCAAACTTTGC
GTAGTGTTGGGTATCTTTTAAAAGATGTTCAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB D4I4V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ciaR Streptococcus pneumoniae R6

100

100

1

  ciaR Streptococcus pneumoniae D39

100

100

1

  ciaR Streptococcus pneumoniae Rx1

100

100

1

  ciaR Streptococcus mutans UA159

88.393

100

0.884

  covR Lactococcus lactis subsp. lactis strain DGCC12653

36.726

100

0.371

  vicR Streptococcus mutans UA159

35.622

100

0.371


Multiple sequence alignment    



References


[1] Ozcan Gazioglu et al. (2023) The involvement of CiaR and the CiaR-regulated serine protease HtrA in thermal adaptation of Streptococcus pneumoniae. Microbiology (Reading, England) 169(2):001304. [PMID: 36811449]
[2] Sabrina Kaiser et al. (2020) Control of acetyl phosphate-dependent phosphorylation of the response regulator CiaR by acetate kinase in Streptococcus pneumoniae. Microbiology (Reading, England) 166(4):411-421. [PMID: 32553069]
[3] Anke Laux et al. (2015) Control of competence by related non-coding csRNAs in Streptococcus pneumoniae R6. Frontiers in Genetics 6:246. [PMID: 26257773]
[4] Anke Schnorpfeil et al. (2013) Target evaluation of the non-coding csRNAs reveals a link of the two-component regulatory system CiaRH to competence control in Streptococcus pneumoniae R6. Molecular Microbiology 89(2):334-49. [PMID: 23710838]
[5] Marco Cassone et al. (2012) The HtrA protease from Streptococcus pneumoniae digests both denatured proteins and the competence-stimulating peptide. The Journal of Biological Chemistry 287(46):38449-59. [PMID: 23012372]
[6] Alexander Halfmann et al. (2011) Activity of the two-component regulatory system CiaRH in Streptococcus pneumoniae R6. Journal of Molecular Microbiology And Biotechnology 20(2):96-104. [PMID: 21422763]
[7] Miriam Müller et al. (2011) Effect of new alleles of the histidine kinase gene ciaH on the activity of the response regulator CiaR in Streptococcus pneumoniae R6. Microbiology (Reading, England) 157(Pt 11):3104-3112. [PMID: 21903754]
[8] Patrick Marx et al. (2010) Identification of genes for small non-coding RNAs that belong to the regulon of the two-component regulatory system CiaRH in Streptococcus. BMC Genomics 11:661. [PMID: 21106082]
[9] Alexander Halfmann et al. (2007) Identification of the genes directly controlled by the response regulator CiaR in Streptococcus pneumoniae: five out of 15 promoters drive expression of small non-coding RNAs. Molecular Microbiology 66(1):110-26. [PMID: 17725562]
[10] M E Sebert et al. (2005) Pneumococcal HtrA protease mediates inhibition of competence by the CiaRH two-component signaling system. Journal of Bacteriology 187(12):3969-79. [PMID: 15937159]
[11] Adilia Dagkessamanskaia et al. (2004) Interconnection of competence, stress and CiaR regulons in Streptococcus pneumoniae: competence triggers stationary phase autolysis of ciaR mutant cells. Molecular Microbiology 51(4):1071-86. [PMID: 14763981]
[12] Yasser Musa Ibrahim et al. (2004) Control of virulence by the two-component system CiaR/H is mediated via HtrA, a major virulence factor of Streptococcus pneumoniae. Journal of Bacteriology 186(16):5258-66. [PMID: 15292127]
[13] Thorsten Mascher et al. (2003) The Streptococcus pneumoniae cia regulon: CiaR target sites and transcription profile analysis. Journal of Bacteriology 185(1):60-70. [PMID: 12486041]
[14] Dorothea Zähner et al. (2002) The ciaR/ciaH regulatory network of Streptococcus pneumoniae. Journal of Molecular Microbiology And Biotechnology 4(3):211-6. [PMID: 11931549]
[15] M E Sebert et al. (2002) Microarray-based identification of htrA, a Streptococcus pneumoniae gene that is regulated by the CiaRH two-component system and contributes to nasopharyngeal colonization. Infection And Immunity 70(8):4059-67. [PMID: 12117912]
[16] Philippe Giammarinaro et al. (1999) Genetic and physiological studies of the CiaH-CiaR two-component signal-transducing system involved in cefotaxime resistance and competence of Streptococcus pneumoniae. Microbiology (Reading, England) 145 ( Pt 8):1859-1869. [PMID: 10463152]