Detailed information
Overview
| Name | ciaR | Type | Regulator |
| Locus tag | KZH43_RS03475 | Genome accession | NZ_CP079923 |
| Coordinates | 703100..703774 (+) | Length | 224 a.a. |
| NCBI ID | WP_000590640.1 | Uniprot ID | D4I4V1 |
| Organism | Streptococcus pneumoniae Rx1 | ||
| Function | repress competence development; post-transcriptional repression of CSP production Competence regulation |
||
Function
CiaRH negatively regulates competence development by controlling the expression of csRNAs (cia-dependent small RNAs) that target comC. These csRNAs post-transcriptionally regulate comC, thereby influencing the initiation of the competence cascade. A hyperactive CiaRH system might suppress competence development by increasing the level of HtrA at the outer surface of the cytoplasmic membrane.
Genomic Context
Location: 698100..708774
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZH43_RS03455 (KZH43_03460) | - | 698268..698996 (+) | 729 | WP_000418692.1 | GNAT family N-acetyltransferase | - |
| KZH43_RS03460 (KZH43_03465) | - | 699038..699907 (+) | 870 | WP_000795797.1 | putative PEP-binding protein | - |
| KZH43_RS03465 (KZH43_03470) | - | 699882..700322 (+) | 441 | WP_001856133.1 | ASCH domain-containing protein | - |
| KZH43_RS03470 (KZH43_03475) | - | 700445..702991 (+) | 2547 | WP_001149118.1 | M1 family metallopeptidase | - |
| KZH43_RS03475 (KZH43_03480) | ciaR | 703100..703774 (+) | 675 | WP_000590640.1 | two-component system response regulator CiaR | Regulator |
| KZH43_RS03480 (KZH43_03485) | ciaH | 703764..705098 (+) | 1335 | WP_000491790.1 | two-component system sensor histidine kinase CiaH | Regulator |
| KZH43_RS03485 (KZH43_03490) | - | 705132..705419 (-) | 288 | WP_001145224.1 | DUF3270 domain-containing protein | - |
| KZH43_RS03490 (KZH43_03495) | - | 705559..706488 (+) | 930 | WP_000411858.1 | peptidase U32 family protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| ciaR | htrA | positive effect |
| htrA | comEA/celA/cilE | negative effect |
| htrA | comC/comC1 | negative effect |
| comC/comC1 | comD/comD1 | positive effect |
| comB | comC/comC1 | positive effect |
| ciaR | comC/comC1 | negative effect |
| ciaH | comC/comC1 | negative effect |
| comA | comC/comC1 | positive effect |
| comE | comC/comC1 | positive effect |
| htrA | comEC/celB | negative effect |
| ciaH | htrA | positive effect |
| comD/comD1 | comE | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comD/comD1 | positive effect |
| comE | comM | positive effect |
| comE | comW | positive effect |
| stkP | comE | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comW | comX/comX1 | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| comW | comX/comX2 | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| comM | cbpD | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| mecA | comW | negative effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
Sequence
Protein
Download Length: 224 a.a. Molecular weight: 25466.29 Da Isoelectric Point: 4.3283
MIKILLVEDDLGLSNSVFDFLDDFADVMQVFDGEEGLYEAESGVYDLILLDLMLPEKNGFQVLKELREKGITTPVLIMTA
KESLDDKGHGFELGADDYLTKPFYLEELKMRIQALLKRSGKFNENTLTYGNIVVNLSTNTVKVEDTPVELLGKEFDLLVY
FLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLKGTTFAENLQTLRSVGYLLKDVQ
Nucleotide
Download Length: 675 bp
ATGATAAAAATCTTATTGGTTGAGGATGACCTAGGTCTGTCAAATTCAGTATTTGACTTTTTAGACGATTTTGCGGATGT
TATGCAGGTATTTGATGGAGAAGAAGGTCTCTACGAAGCTGAGAGTGGTGTCTATGACTTGATTTTGCTGGATTTGATGT
TGCCAGAAAAAAATGGTTTCCAAGTCTTAAAAGAATTGCGTGAAAAGGGAATTACGACACCAGTTCTGATTATGACTGCC
AAGGAAAGTTTGGATGACAAGGGACATGGATTTGAACTGGGAGCGGATGATTATCTGACCAAACCTTTCTACCTAGAAGA
ACTTAAAATGCGGATTCAGGCCCTTCTCAAACGTTCAGGGAAGTTTAATGAAAACACCTTGACTTATGGGAATATCGTGG
TTAATTTATCAACCAATACCGTTAAAGTTGAAGATACTCCTGTCGAATTGCTGGGGAAAGAGTTCGATTTACTAGTTTAT
TTCCTTCAAAATCAAAATGTGATTTTGCCTAAGACGCAGATTTTTGACCGTCTATGGGGATTTGATAGTGATACAACGAT
TTCGGTTGTCGAAGTCTATGTTTCAAAAGTCCGTAAGAAATTAAAGGGAACCACTTTTGCAGAGAATTTGCAAACCTTGC
GTAGTGTTGGGTATCTTTTAAAAGATGTTCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ciaR | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| ciaR | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| ciaR | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| ciaR | Streptococcus mutans UA159 |
88.393 |
100 |
0.884 |
| covR | Lactococcus lactis subsp. lactis strain DGCC12653 |
36.726 |
100 |
0.371 |
| vicR | Streptococcus mutans UA159 |
35.622 |
100 |
0.371 |
Multiple sequence alignment
References
| [1] | Ozcan Gazioglu et al. (2023) The involvement of CiaR and the CiaR-regulated serine protease HtrA in thermal adaptation of Streptococcus pneumoniae. Microbiology (Reading, England) 169(2):001304. [PMID: 36811449] |
| [2] | Sabrina Kaiser et al. (2020) Control of acetyl phosphate-dependent phosphorylation of the response regulator CiaR by acetate kinase in Streptococcus pneumoniae. Microbiology (Reading, England) 166(4):411-421. [PMID: 32553069] |
| [3] | Anke Laux et al. (2015) Control of competence by related non-coding csRNAs in Streptococcus pneumoniae R6. Frontiers in Genetics 6:246. [PMID: 26257773] |
| [4] | Anke Schnorpfeil et al. (2013) Target evaluation of the non-coding csRNAs reveals a link of the two-component regulatory system CiaRH to competence control in Streptococcus pneumoniae R6. Molecular Microbiology 89(2):334-49. [PMID: 23710838] |
| [5] | Marco Cassone et al. (2012) The HtrA protease from Streptococcus pneumoniae digests both denatured proteins and the competence-stimulating peptide. The Journal of Biological Chemistry 287(46):38449-59. [PMID: 23012372] |
| [6] | Alexander Halfmann et al. (2011) Activity of the two-component regulatory system CiaRH in Streptococcus pneumoniae R6. Journal of Molecular Microbiology And Biotechnology 20(2):96-104. [PMID: 21422763] |
| [7] | Miriam Müller et al. (2011) Effect of new alleles of the histidine kinase gene ciaH on the activity of the response regulator CiaR in Streptococcus pneumoniae R6. Microbiology (Reading, England) 157(Pt 11):3104-3112. [PMID: 21903754] |
| [8] | Patrick Marx et al. (2010) Identification of genes for small non-coding RNAs that belong to the regulon of the two-component regulatory system CiaRH in Streptococcus. BMC Genomics 11:661. [PMID: 21106082] |
| [9] | Alexander Halfmann et al. (2007) Identification of the genes directly controlled by the response regulator CiaR in Streptococcus pneumoniae: five out of 15 promoters drive expression of small non-coding RNAs. Molecular Microbiology 66(1):110-26. [PMID: 17725562] |
| [10] | M E Sebert et al. (2005) Pneumococcal HtrA protease mediates inhibition of competence by the CiaRH two-component signaling system. Journal of Bacteriology 187(12):3969-79. [PMID: 15937159] |
| [11] | Adilia Dagkessamanskaia et al. (2004) Interconnection of competence, stress and CiaR regulons in Streptococcus pneumoniae: competence triggers stationary phase autolysis of ciaR mutant cells. Molecular Microbiology 51(4):1071-86. [PMID: 14763981] |
| [12] | Yasser Musa Ibrahim et al. (2004) Control of virulence by the two-component system CiaR/H is mediated via HtrA, a major virulence factor of Streptococcus pneumoniae. Journal of Bacteriology 186(16):5258-66. [PMID: 15292127] |
| [13] | Thorsten Mascher et al. (2003) The Streptococcus pneumoniae cia regulon: CiaR target sites and transcription profile analysis. Journal of Bacteriology 185(1):60-70. [PMID: 12486041] |
| [14] | Dorothea Zähner et al. (2002) The ciaR/ciaH regulatory network of Streptococcus pneumoniae. Journal of Molecular Microbiology And Biotechnology 4(3):211-6. [PMID: 11931549] |
| [15] | M E Sebert et al. (2002) Microarray-based identification of htrA, a Streptococcus pneumoniae gene that is regulated by the CiaRH two-component system and contributes to nasopharyngeal colonization. Infection And Immunity 70(8):4059-67. [PMID: 12117912] |
| [16] | Philippe Giammarinaro et al. (1999) Genetic and physiological studies of the CiaH-CiaR two-component signal-transducing system involved in cefotaxime resistance and competence of Streptococcus pneumoniae. Microbiology (Reading, England) 145 ( Pt 8):1859-1869. [PMID: 10463152] |