Detailed information
Overview
| Name | htrA | Type | Regulator |
| Locus tag | KZH43_RS10270 | Genome accession | NZ_CP079923 |
| Coordinates | 2027977..2029158 (+) | Length | 393 a.a. |
| NCBI ID | WP_000681597.1 | Uniprot ID | A0A0H2US63 |
| Organism | Streptococcus pneumoniae Rx1 | ||
| Function | degrading CSP; selective degradation of ComEA and ComEC Competence regulation |
||
Function
The htrA gene encodes a protease that functions in both general stress response and as an error sensor that specifically represses genetic competence when the overall level of biosynthetic errors in cellular proteins is low. HtrA digests the competence-stimulating peptide (CSP), constituting the primary extracytoplasmic CSP-degrading activity in cultures of S. pneumoniae. This digestion of CSP by HtrA is reduced in the presence of other unfolded proteins that serve as alternative targets for degradation, providing a mechanism by which HtrA monitors the frequency of biosynthetic errors resulting in protein misfolding. HtrA also mediates selective degradation of ComEA and ComEC.
Genomic Context
Location: 2022977..2034158
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZH43_RS10230 (KZH43_10225) | - | 2024028..2024570 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| KZH43_RS10245 (KZH43_10240) | comE | 2024813..2025565 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| KZH43_RS10250 (KZH43_10245) | comD/comD1 | 2025562..2026887 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| KZH43_RS10255 (KZH43_10250) | comC/comC1 | 2026908..2027033 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| KZH43_RS10265 (KZH43_10260) | rlmH | 2027315..2027794 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| KZH43_RS10270 (KZH43_10265) | htrA | 2027977..2029158 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| KZH43_RS10275 (KZH43_10270) | spo0J | 2029216..2029974 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| htrA | comEA/celA/cilE | negative effect |
| htrA | comC/comC1 | negative effect |
| htrA | comEC/celB | negative effect |
| ciaR | htrA | positive effect |
| ciaH | htrA | positive effect |
| comC/comC1 | comD/comD1 | positive effect |
| comD/comD1 | comE | positive effect |
| comE | comD/comD1 | positive effect |
| comB | comC/comC1 | positive effect |
| comE | comB | positive effect |
| ciaR | comC/comC1 | negative effect |
| ciaH | comC/comC1 | negative effect |
| comA | comC/comC1 | positive effect |
| comE | comA | positive effect |
| comE | comC/comC1 | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comM | positive effect |
| comE | comW | positive effect |
| stkP | comE | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comW | comX/comX1 | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| comW | comX/comX2 | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| comM | cbpD | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| mecA | comW | negative effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
Sequence
Protein
Download Length: 393 a.a. Molecular weight: 41841.72 Da Isoelectric Point: 6.8902
MKHLKTFYKKWFQLLVVIVISFFSGALGSFSITQLTQKSSVNNSNNNSTITQTAYKNENSTTQAVNKVKDAVVSVITYSA
NRQNSVFGNDDTDTDSQRISSEGSGVIYKKNDKEAYIVTNNHVINGASKVDIRLSDGTKVPGEIVGADTFSDIAVVKISS
EKVTTVAEFGDSSKLTVGETAIAIGSPLGSEYANTVTQGIVSSLNRNVSLKSEDGQAISTKAIQTDTAINPGNSGGPLIN
IQGQVIGITSSKIATNGGTSVEGLGFAIPANDAINIIEQLEKNGKVTRPALGIQMVNLSNVSTSDIRRLNIPSNVTSGVI
VRSVQSNMPANGHLEKYDVITKVDDKEIASSTDLQSALYNHSIGDTIKITYYRNGKEETTSIKLNKSSGDLES
Nucleotide
Download Length: 1182 bp
ATGAAACATCTAAAAACATTTTACAAAAAATGGTTTCAATTATTAGTCGTTATCGTCATTAGCTTTTTTAGTGGAGCCTT
GGGTAGTTTTTCAATAACTCAACTAACTCAAAAAAGTAGTGTAAACAACTCTAACAACAATAGTACTATTACACAAACTG
CCTATAAGAACGAAAATTCAACAACACAGGCTGTTAACAAAGTAAAAGATGCTGTTGTTTCTGTTATTACTTATTCGGCA
AACAGACAAAATAGCGTATTTGGCAATGATGATACTGACACAGATTCTCAGCGAATCTCTAGTGAAGGATCTGGAGTTAT
TTATAAAAAGAATGATAAAGAAGCTTACATCGTCACCAACAATCACGTTATAAATGGCGCCAGCAAAGTAGATATTCGAT
TGTCAGATGGGACTAAAGTACCTGGAGAAATTGTCGGAGCTGACACTTTCTCTGATATTGCTGTCGTCAAAATCTCTTCA
GAAAAAGTGACAACAGTAGCTGAGTTTGGTGATTCTAGTAAGTTAACTGTAGGAGAAACTGCTATTGCCATCGGTAGCCC
GTTAGGTTCTGAATATGCAAATACTGTCACTCAAGGTATCGTATCCAGTCTCAATAGAAATGTATCCTTAAAATCGGAAG
ATGGACAAGCTATTTCTACAAAAGCCATCCAAACTGATACTGCTATTAACCCAGGTAACTCTGGCGGCCCACTGATCAAT
ATTCAAGGGCAGGTTATCGGAATTACCTCAAGTAAAATTGCTACAAATGGAGGAACATCTGTAGAAGGTCTTGGTTTCGC
AATTCCTGCAAATGATGCTATCAATATTATTGAACAGTTAGAAAAAAACGGAAAAGTGACGCGTCCAGCTTTGGGAATCC
AGATGGTTAATTTATCTAATGTGAGTACAAGCGACATCAGAAGACTCAATATTCCAAGTAATGTTACATCTGGTGTAATT
GTTCGTTCGGTACAAAGTAATATGCCTGCCAATGGTCACCTTGAAAAATACGATGTAATTACAAAAGTAGATGACAAAGA
GATTGCTTCATCAACAGACTTACAAAGTGCTCTTTACAACCATTCTATCGGAGACACCATTAAGATAACCTACTATCGTA
ACGGGAAAGAAGAAACTACCTCTATCAAACTTAACAAGAGTTCAGGTGATTTAGAATCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| htrA | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| htrA | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| htrA | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| htrA | Streptococcus mitis NCTC 12261 |
97.201 |
100 |
0.972 |
| htrA | Streptococcus gordonii str. Challis substr. CH1 |
66.414 |
100 |
0.669 |
| htrA | Streptococcus mutans UA159 |
54.569 |
100 |
0.547 |
Multiple sequence alignment
References
| [1] | Jada L George et al. (2024) Streptococcus pneumoniae secretion chaperones PrsA, SlrA, and HtrA are required for competence, antibiotic resistance, colonization, and invasive disease. Infection And Immunity 92(2):e0049023. [PMID: 38226817] |
| [2] | Ozcan Gazioglu et al. (2023) The involvement of CiaR and the CiaR-regulated serine protease HtrA in thermal adaptation of Streptococcus pneumoniae. Microbiology (Reading, England) 169(2):001304. [PMID: 36811449] |
| [3] | Mickaël Maziero et al. (2023) Fever-like temperature bursts promote competence development via an HtrA-dependent pathway in Streptococcus pneumoniae. PLoS Genetics 19(9):e1010946. [PMID: 37699047] |
| [4] | Katharina Peters et al. (2021) New Insights into Beta-Lactam Resistance of Streptococcus pneumoniae: Serine Protease HtrA Degrades Altered Penicillin-Binding Protein 2x. Microorganisms 9(8):1685. [PMID: 34442764] |
| [5] | Yanni Liu et al. (2019) HtrA-mediated selective degradation of DNA uptake apparatus accelerates termination of pneumococcal transformation. Molecular Microbiology 112(4):1308-1325. [PMID: 31396996] |
| [6] | Travis J Kochan et al. (2013) The HtrA protease of Streptococcus pneumoniae controls density-dependent stimulation of the bacteriocin blp locus via disruption of pheromone secretion. Journal of Bacteriology 195(7):1561-72. [PMID: 23354751] |
| [7] | Sacha F de Stoppelaar et al. (2013) Streptococcus pneumoniae serine protease HtrA, but not SFP or PrtA, is a major virulence factor in pneumonia. PloS One 8(11):e80062. [PMID: 24244609] |
| [8] | Marco Cassone et al. (2012) The HtrA protease from Streptococcus pneumoniae digests both denatured proteins and the competence-stimulating peptide. The Journal of Biological Chemistry 287(46):38449-59. [PMID: 23012372] |
| [9] | Kai Fan et al. (2011) Solution structure of HtrA PDZ domain from Streptococcus pneumoniae and its interaction with YYF-COOH containing peptides. Journal of Structural Biology 176(1):16-23. [PMID: 21757011] |
| [10] | Kathleen E Stevens et al. (2011) Competence in Streptococcus pneumoniae is regulated by the rate of ribosomal decoding errors. MBio 2(5):e00071-11. [PMID: 21933920] |
| [11] | Ho-Ching Tiffany Tsui et al. (2011) Dynamic distribution of the SecA and SecY translocase subunits and septal localization of the HtrA surface chaperone/protease during Streptococcus pneumoniae D39 cell division. MBio 2(5):e00202-11. [PMID: 21990615] |
| [12] | Kai Fan et al. (2010) 1H, 13C and 15N resonance assignment of the PDZ domain of HtrA from Streptococcus pneumoniae. Biomolecular NMR Assignments 4(1):79-82. [PMID: 20437142] |
| [13] | Suzanne Dawid et al. (2009) Bacteriocin activity of Streptococcus pneumoniae is controlled by the serine protease HtrA via posttranscriptional regulation. Journal of Bacteriology 191(5):1509-18. [PMID: 19103930] |
| [14] | M E Sebert et al. (2005) Pneumococcal HtrA protease mediates inhibition of competence by the CiaRH two-component signaling system. Journal of Bacteriology 187(12):3969-79. [PMID: 15937159] |
| [15] | Yasser Musa Ibrahim et al. (2004) Role of HtrA in the virulence and competence of Streptococcus pneumoniae. Infection And Immunity 72(6):3584-91. [PMID: 15155668] |
| [16] | Yasser Musa Ibrahim et al. (2004) Control of virulence by the two-component system CiaR/H is mediated via HtrA, a major virulence factor of Streptococcus pneumoniae. Journal of Bacteriology 186(16):5258-66. [PMID: 15292127] |
| [17] | M E Sebert et al. (2002) Microarray-based identification of htrA, a Streptococcus pneumoniae gene that is regulated by the CiaRH two-component system and contributes to nasopharyngeal colonization. Infection And Immunity 70(8):4059-67. [PMID: 12117912] |