Detailed information    

experimental Experimentally validated

Overview


Name   htrA   Type   Regulator
Locus tag   SPD_RS10945 Genome accession   NC_008533
Coordinates   2043907..2045088 (+) Length   393 a.a.
NCBI ID   WP_000681597.1    Uniprot ID   A0A0H2US63
Organism   Streptococcus pneumoniae D39     
Function   degrading CSP; selective degradation of ComEA and ComEC   
Competence regulation

Function


The htrA gene encodes a protease that functions in both general stress response and as an error sensor that specifically represses genetic competence when the overall level of biosynthetic errors in cellular proteins is low. HtrA digests the competence-stimulating peptide (CSP), constituting the primary extracytoplasmic CSP-degrading activity in cultures of S. pneumoniae. This digestion of CSP by HtrA is reduced in the presence of other unfolded proteins that serve as alternative targets for degradation, providing a mechanism by which HtrA monitors the frequency of biosynthetic errors resulting in protein misfolding. HtrA also mediates selective degradation of ComEA and ComEC.


Genomic Context


Location: 2038907..2050088
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPD_RS10905 (SPD_2060) - 2039958..2040500 (+) 543 WP_001158266.1 TetR/AcrR family transcriptional regulator -
  SPD_RS10920 (SPD_2063) comE 2040743..2041495 (-) 753 WP_000866065.1 competence system response regulator transcription factor ComE Regulator
  SPD_RS10925 (SPD_2064) comD/comD1 2041492..2042817 (-) 1326 WP_000362880.1 competence system sensor histidine kinase ComD Regulator
  SPD_RS10930 (SPD_2065) comC/comC1 2042838..2042963 (-) 126 WP_000799689.1 competence-stimulating peptide ComC Regulator
  SPD_RS10940 (SPD_2067) rlmH 2043245..2043724 (-) 480 WP_000695929.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  SPD_RS10945 (SPD_2068) htrA 2043907..2045088 (+) 1182 WP_000681597.1 S1C family serine protease Regulator
  SPD_RS10950 (SPD_2069) spo0J 2045146..2045904 (+) 759 WP_000410378.1 ParB/RepB/Spo0J family partition protein Regulator

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  htrA comEA/celA/cilE negative effect
  htrA comEC/celB negative effect
  htrA comC/comC1 negative effect
  ciaR htrA positive effect
  ciaH htrA positive effect
  comC/comC1 comD/comD1 positive effect
  comD/comD1 comE positive effect
  comE comD/comD1 positive effect
  ccpA comD/comD1 positive effect
  comE comC/comC1 positive effect
  comE comM positive effect
  comE comW positive effect
  comE comA positive effect
  comE comB positive effect
  comE comE positive effect
  comE comX/comX1 positive effect
  comE comX/comX2 positive effect
  stkP comE positive effect
  ccpA comE positive effect
  comA comC/comC1 positive effect
  ccpA comC/comC1 positive effect
  comB comC/comC1 positive effect
  ciaR comC/comC1 negative effect
  ciaH comC/comC1 negative effect
  comM cbpD negative effect
  comW comX/comX1 positive effect
  comW comX/comX2 positive effect
  mecA comW negative effect
  clpC comW negative effect
  clpP comW negative effect
  comX/comX1 late competence genes positive effect
  clpE comX/comX1 negative effect
  clpP comX/comX1 negative effect
  comX/comX2 late competence genes positive effect
  clpE comX/comX2 negative effect
  clpP comX/comX2 negative effect
  cbpD lytA positive effect
  cbpD lytC positive effect
  comX/comX2 late competence genes positive effect
  comX/comX1 late competence genes positive effect

Sequence


Protein


Download         Length: 393 a.a.        Molecular weight: 41841.72 Da        Isoelectric Point: 6.8902

>NTDB_id=215 SPD_RS10945 WP_000681597.1 2043907..2045088(+) (htrA) [Streptococcus pneumoniae D39]
MKHLKTFYKKWFQLLVVIVISFFSGALGSFSITQLTQKSSVNNSNNNSTITQTAYKNENSTTQAVNKVKDAVVSVITYSA
NRQNSVFGNDDTDTDSQRISSEGSGVIYKKNDKEAYIVTNNHVINGASKVDIRLSDGTKVPGEIVGADTFSDIAVVKISS
EKVTTVAEFGDSSKLTVGETAIAIGSPLGSEYANTVTQGIVSSLNRNVSLKSEDGQAISTKAIQTDTAINPGNSGGPLIN
IQGQVIGITSSKIATNGGTSVEGLGFAIPANDAINIIEQLEKNGKVTRPALGIQMVNLSNVSTSDIRRLNIPSNVTSGVI
VRSVQSNMPANGHLEKYDVITKVDDKEIASSTDLQSALYNHSIGDTIKITYYRNGKEETTSIKLNKSSGDLES

Nucleotide


Download         Length: 1182 bp        

>NTDB_id=215 SPD_RS10945 WP_000681597.1 2043907..2045088(+) (htrA) [Streptococcus pneumoniae D39]
ATGAAACATCTAAAAACATTTTACAAAAAATGGTTTCAATTATTAGTCGTTATCGTCATTAGCTTTTTTAGTGGAGCCTT
GGGTAGTTTTTCAATAACTCAACTAACTCAAAAAAGTAGTGTAAACAACTCTAACAACAATAGTACTATTACACAAACTG
CCTATAAGAACGAAAATTCAACAACACAGGCTGTTAACAAAGTAAAAGATGCTGTTGTTTCTGTTATTACTTATTCGGCA
AACAGACAAAATAGCGTATTTGGCAATGATGATACTGACACAGATTCTCAGCGAATCTCTAGTGAAGGATCTGGAGTTAT
TTATAAAAAGAATGATAAAGAAGCTTACATCGTCACCAACAATCACGTTATAAATGGCGCCAGCAAAGTAGATATTCGAT
TGTCAGATGGGACTAAAGTACCTGGAGAAATTGTCGGAGCTGACACTTTCTCTGATATTGCTGTCGTCAAAATCTCTTCA
GAAAAAGTGACAACAGTAGCTGAGTTTGGTGATTCTAGTAAGTTAACTGTAGGAGAAACTGCTATTGCCATCGGTAGCCC
GTTAGGTTCTGAATATGCAAATACTGTCACTCAAGGTATCGTATCCAGTCTCAATAGAAATGTATCCTTAAAATCGGAAG
ATGGACAAGCTATTTCTACAAAAGCCATCCAAACTGATACTGCTATTAACCCAGGTAACTCTGGCGGCCCACTGATCAAT
ATTCAAGGGCAGGTTATCGGAATTACCTCAAGTAAAATTGCTACAAATGGAGGAACATCTGTAGAAGGTCTTGGTTTCGC
AATTCCTGCAAATGATGCTATCAATATTATTGAACAGTTAGAAAAAAACGGAAAAGTGACGCGTCCAGCTTTGGGAATCC
AGATGGTTAATTTATCTAATGTGAGTACAAGCGACATCAGAAGACTCAATATTCCAAGTAATGTTACATCTGGTGTAATT
GTTCGTTCGGTACAAAGTAATATGCCTGCCAATGGTCACCTTGAAAAATACGATGTAATTACAAAAGTAGATGACAAAGA
GATTGCTTCATCAACAGACTTACAAAGTGCTCTTTACAACCATTCTATCGGAGACACCATTAAGATAACCTACTATCGTA
ACGGGAAAGAAGAAACTACCTCTATCAAACTTAACAAGAGTTCAGGTGATTTAGAATCTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 2L97

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  htrA Streptococcus pneumoniae TIGR4

100

100

1

  htrA Streptococcus pneumoniae R6

100

100

1

  htrA Streptococcus pneumoniae Rx1

100

100

1

  htrA Streptococcus mitis NCTC 12261

97.201

100

0.972

  htrA Streptococcus gordonii str. Challis substr. CH1

66.414

100

0.669

  htrA Streptococcus mutans UA159

54.569

100

0.547


Multiple sequence alignment    



References


[1] Jada L George et al. (2024) Streptococcus pneumoniae secretion chaperones PrsA, SlrA, and HtrA are required for competence, antibiotic resistance, colonization, and invasive disease. Infection And Immunity 92(2):e0049023. [PMID: 38226817]
[2] Ozcan Gazioglu et al. (2023) The involvement of CiaR and the CiaR-regulated serine protease HtrA in thermal adaptation of Streptococcus pneumoniae. Microbiology (Reading, England) 169(2):001304. [PMID: 36811449]
[3] Mickaël Maziero et al. (2023) Fever-like temperature bursts promote competence development via an HtrA-dependent pathway in Streptococcus pneumoniae. PLoS Genetics 19(9):e1010946. [PMID: 37699047]
[4] Katharina Peters et al. (2021) New Insights into Beta-Lactam Resistance of Streptococcus pneumoniae: Serine Protease HtrA Degrades Altered Penicillin-Binding Protein 2x. Microorganisms 9(8):1685. [PMID: 34442764]
[5] Yanni Liu et al. (2019) HtrA-mediated selective degradation of DNA uptake apparatus accelerates termination of pneumococcal transformation. Molecular Microbiology 112(4):1308-1325. [PMID: 31396996]
[6] Travis J Kochan et al. (2013) The HtrA protease of Streptococcus pneumoniae controls density-dependent stimulation of the bacteriocin blp locus via disruption of pheromone secretion. Journal of Bacteriology 195(7):1561-72. [PMID: 23354751]
[7] Sacha F de Stoppelaar et al. (2013) Streptococcus pneumoniae serine protease HtrA, but not SFP or PrtA, is a major virulence factor in pneumonia. PloS One 8(11):e80062. [PMID: 24244609]
[8] Marco Cassone et al. (2012) The HtrA protease from Streptococcus pneumoniae digests both denatured proteins and the competence-stimulating peptide. The Journal of Biological Chemistry 287(46):38449-59. [PMID: 23012372]
[9] Kai Fan et al. (2011) Solution structure of HtrA PDZ domain from Streptococcus pneumoniae and its interaction with YYF-COOH containing peptides. Journal of Structural Biology 176(1):16-23. [PMID: 21757011]
[10] Kathleen E Stevens et al. (2011) Competence in Streptococcus pneumoniae is regulated by the rate of ribosomal decoding errors. MBio 2(5):e00071-11. [PMID: 21933920]
[11] Ho-Ching Tiffany Tsui et al. (2011) Dynamic distribution of the SecA and SecY translocase subunits and septal localization of the HtrA surface chaperone/protease during Streptococcus pneumoniae D39 cell division. MBio 2(5):e00202-11. [PMID: 21990615]
[12] Kai Fan et al. (2010) 1H, 13C and 15N resonance assignment of the PDZ domain of HtrA from Streptococcus pneumoniae. Biomolecular NMR Assignments 4(1):79-82. [PMID: 20437142]
[13] Suzanne Dawid et al. (2009) Bacteriocin activity of Streptococcus pneumoniae is controlled by the serine protease HtrA via posttranscriptional regulation. Journal of Bacteriology 191(5):1509-18. [PMID: 19103930]
[14] M E Sebert et al. (2005) Pneumococcal HtrA protease mediates inhibition of competence by the CiaRH two-component signaling system. Journal of Bacteriology 187(12):3969-79. [PMID: 15937159]
[15] Yasser Musa Ibrahim et al. (2004) Role of HtrA in the virulence and competence of Streptococcus pneumoniae. Infection And Immunity 72(6):3584-91. [PMID: 15155668]
[16] Yasser Musa Ibrahim et al. (2004) Control of virulence by the two-component system CiaR/H is mediated via HtrA, a major virulence factor of Streptococcus pneumoniae. Journal of Bacteriology 186(16):5258-66. [PMID: 15292127]
[17] M E Sebert et al. (2002) Microarray-based identification of htrA, a Streptococcus pneumoniae gene that is regulated by the CiaRH two-component system and contributes to nasopharyngeal colonization. Infection And Immunity 70(8):4059-67. [PMID: 12117912]