Detailed information
Overview
| Name | comEA/celA/cilE | Type | Machinery gene |
| Locus tag | SPD_RS04535 | Genome accession | NC_008533 |
| Coordinates | 857497..858147 (+) | Length | 216 a.a. |
| NCBI ID | WP_000387330.1 | Uniprot ID | Q8DQ41 |
| Organism | Streptococcus pneumoniae D39 | ||
| Function | dsDNA binding to the cell surface DNA binding and uptake |
||
Function
ComEA is a DNA-binding protein critical for the uptake of extracellular DNA during natural transformation. It binds to double-stranded DNA (dsDNA) at the cell surface, facilitating its transport into the cell through the competence-specific DNA uptake machinery. ComEA works in concert with other proteins such as ComEC, which is involved in the transport of single-stranded DNA into the cell.
Genomic Context
Location: 852497..863147
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPD_RS04490 (SPD_0837) | - | 852980..853195 (+) | 216 | WP_001232082.1 | YozE family protein | - |
| SPD_RS04495 (SPD_0838) | - | 853281..854249 (+) | 969 | WP_000658183.1 | PhoH family protein | - |
| SPD_RS04505 (SPD_0839) | - | 854442..854942 (+) | 501 | WP_000566988.1 | GNAT family N-acetyltransferase | - |
| SPD_RS04510 (SPD_0840) | - | 854945..855271 (+) | 327 | Protein_850 | TfoX/Sxy family protein | - |
| SPD_RS11620 (SPD_0841) | ald | 855572..856683 (-) | 1112 | Protein_851 | alanine dehydrogenase | - |
| SPD_RS04530 (SPD_0842) | - | 856860..857429 (+) | 570 | WP_000443899.1 | GNAT family N-acetyltransferase | - |
| SPD_RS04535 (SPD_0843) | comEA/celA/cilE | 857497..858147 (+) | 651 | WP_000387330.1 | ComEA family DNA-binding protein | Machinery gene |
| SPD_RS04540 (SPD_0844) | comEC/celB | 858131..860371 (+) | 2241 | WP_000942407.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| SPD_RS04545 | - | 860550..860738 (+) | 189 | WP_010976492.1 | hypothetical protein | - |
| SPD_RS04550 (SPD_0845) | - | 860770..861357 (+) | 588 | Protein_856 | ATP-binding cassette domain-containing protein | - |
| SPD_RS04555 (SPD_0846) | - | 861361..862542 (+) | 1182 | WP_000655958.1 | ABC transporter permease | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| htrA | comEA/celA/cilE | negative effect |
| htrA | comEC/celB | negative effect |
| htrA | comC/comC1 | negative effect |
| comC/comC1 | comD/comD1 | positive effect |
| comE | comC/comC1 | positive effect |
| comA | comC/comC1 | positive effect |
| ccpA | comC/comC1 | positive effect |
| comB | comC/comC1 | positive effect |
| ciaR | comC/comC1 | negative effect |
| ciaH | comC/comC1 | negative effect |
| ciaR | htrA | positive effect |
| ciaH | htrA | positive effect |
| comD/comD1 | comE | positive effect |
| comE | comM | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comD/comD1 | positive effect |
| comE | comX/comX2 | positive effect |
| stkP | comE | positive effect |
| ccpA | comE | positive effect |
| ccpA | comD/comD1 | positive effect |
| comM | cbpD | negative effect |
| comW | comX/comX1 | positive effect |
| comW | comX/comX2 | positive effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| comX/comX1 | late competence genes | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| comX/comX2 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
Sequence
Protein
Download Length: 216 a.a. Molecular weight: 23229.65 Da Isoelectric Point: 5.5171
MEAIIEKIKEYKIIVICTGLGLLVGGFFLLKPAPQTPVKETNLQAEVAAVSKDLVSEKEVNKEEKEEPLEQDLITVDVKG
AVKSPGIYDLPVGSRVNDAVQKAGGLTEQADSKSLNLAQKVSDEALVYVPTKGEEAVSQQTGLGTASSISKEKKVNLNKA
SLEELKQVKGLGGKRAQDIIDHREANGKFKSVDELKKVSGIGGKTIEKLKDYVTVD
Nucleotide
Download Length: 651 bp
ATGGAAGCAATTATCGAGAAAATCAAAGAGTATAAAATCATCGTCATCTGTACTGGTCTGGGCTTGCTTGTAGGAGGATT
TTTCCTGCTAAAACCAGCTCCACAAACACCTGTCAAAGAGACGAATTTGCAGGCTGAAGTCGCAGCTGTTTCCAAGGATT
TGGTATCCGAAAAGGAAGTGAACAAGGAAGAAAAGGAAGAACCCCTTGAACAAGATCTAATCACAGTAGATGTCAAAGGT
GCTGTCAAATCGCCAGGGATTTATGACTTGCCTGTAGGTAGTCGAGTCAATGATGCTGTTCAGAAGGCTGGTGGCTTGAC
AGAGCAAGCAGACAGCAAGTCGCTCAATCTAGCTCAGAAAGTTAGTGATGAGGCTCTGGTTTACGTTCCTACTAAGGGAG
AAGAAGCAGTTAGCCAACAGACTGGTTTGGGGACAGCTTCTTCAATAAGCAAGGAAAAGAAGGTCAATCTCAACAAGGCC
AGTCTGGAAGAACTCAAGCAGGTCAAGGGACTGGGAGGAAAACGAGCTCAGGACATTATCGACCATCGTGAGGCAAATGG
CAAGTTCAAGTCAGTAGACGAGCTCAAGAAGGTCTCTGGCATTGGTGGCAAAACAATAGAAAAGCTTAAAGACTATGTTA
CAGTGGATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEA/celA/cilE | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comEA/celA/cilE | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comEA/celA/cilE | Streptococcus pneumoniae TIGR4 |
97.222 |
100 |
0.972 |
| comEA/celA/cilE | Streptococcus mitis NCTC 12261 |
96.296 |
100 |
0.963 |
| comEA/celA/cilE | Streptococcus mitis SK321 |
90.278 |
100 |
0.903 |
| comEA | Lactococcus lactis subsp. cremoris KW2 |
43.172 |
100 |
0.454 |
| Cj0011c | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
49.206 |
79.747 |
0.392 |
| comEA | Streptococcus thermophilus LMD-9 |
39.035 |
98.701 |
0.385 |
| comEA | Bacillus subtilis subsp. subtilis str. 168 |
41.579 |
87.963 |
0.366 |
| comEA | Latilactobacillus sakei subsp. sakei 23K |
33.476 |
100 |
0.361 |
Multiple sequence alignment
References
| [1] | Yanni Liu et al. (2019) HtrA-mediated selective degradation of DNA uptake apparatus accelerates termination of pneumococcal transformation. Molecular Microbiology 112(4):1308-1325. [PMID: 31396996] |
| [2] | Matthieu J Bergé et al. (2013) Midcell recruitment of the DNA uptake and virulence nuclease, EndA, for pneumococcal transformation. PLoS Pathogens 9(9):e1003596. [PMID: 24039578] |
| [3] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [4] | Mathieu Bergé et al. (2002) Uptake of transforming DNA in Gram-positive bacteria: a view from Streptococcus pneumoniae. Molecular Microbiology 45(2):411-21. [PMID: 12123453] |
| [5] | E V Pestova et al. (1998) Isolation and characterization of three Streptococcus pneumoniae transformation-specific loci by use of a lacZ reporter insertion vector. Journal of Bacteriology 180(10):2701-10. [PMID: 9573156] |