Detailed information NTG0001242

Experimentally validated

Overview

• Name: Cj0011c
• Type: Machinery gene
• Locus tag: Cj0011c
• Genome accession: NC_002163
• Coordinates: 16452..16691 (-)
• Length: 79 a.a.
• NCBI ID: YP_002343483.1
• Uniprot ID: Q0PCB4
• Organism: Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
• Function: DNA binding DNA binding and uptake

Function

Cj0011c bound to both single- and double-stranded DNA. DNA binding of Cj0011c is not sequence dependent. Deletion of the cj0011c gene from C. jejuni resulted in 10- to 50-fold reductions in the natural transformation frequency. Different from the B. subtilis ComEA, which is an integral membrane protein, Cj0011c is localized in the periplasmic space of C. jejuni. Cj0011c functions as a periplasmic DNA receptor contributing to the natural transformation of C. jejuni.

Genomic Context

Location: 11452..21691

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Cj0008	-	12644..14395 (+)	1752	YP_002343480.1	hypothetical protein	-
Cj0009	gltD	14398..15843 (+)	1446	YP_002343481.1	glutamate synthase subunit beta	-
Cj0010c	rnhB	15844..16419 (-)	576	YP_002343482.1	ribonuclease HII	-
Cj0011c	Cj0011c	16452..16691 (-)	240	YP_002343483.1	non-specific DNA binding protein	Machinery gene
Cj0012c	rrc	16756..17403 (-)	648	YP_002343484.1	non-heme iron protein	-
Cj0013	ilvD	17563..19239 (+)	1677	YP_002343485.1	dihydroxy-acid dehydratase	-
Cj0014c	-	19251..19775 (-)	525	YP_002343486.1	integral membrane protein	-
Cj0015c	-	19867..21093 (-)	1227	YP_002343487.1	hypothetical protein	-

Sequence

Protein

• Length: 79 a.a.
• Molecular weight: 8852.50 Da
• Isoelectric Point: 10.1677

>NTDB_id=1242 Cj0011c YP_002343483.1 16452..16691(-) (Cj0011c) [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]
MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILEYRKEANFTSIDDLKKVKGIGDKLFEKIKNDITIE

Nucleotide

• Length: 240 bp

>NTDB_id=1242 Cj0011c YP_002343483.1 16452..16691(-) (Cj0011c) [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]
ATGAAAAAATTACTATTTTTATTTTTTGCTTTAACGGCTTTTCTCTTTGGTGCTGTAAATATCAACACTGCAACACTAAA
AGAATTAAAAAGTTTAAATGGTATTGGCGAAGCTAAAGCTAAAGCGATTTTAGAATACCGCAAAGAAGCAAATTTTACAA
GTATTGATGATCTTAAAAAAGTTAAAGGCATAGGTGATAAGCTTTTTGAAAAAATCAAAAATGATATCACAATAGAATAA

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (18-77)

3D structure

• AlphaFold DB: Q0PCB4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comEA	Staphylococcus aureus MW2	57.377	77.215	0.443
comEA	Staphylococcus aureus N315	57.377	77.215	0.443
comEA	Bacillus subtilis subsp. subtilis str. 168	57.377	77.215	0.443
comEA	Acinetobacter baylyi ADP1	57.377	77.215	0.443
comEA	Lactococcus lactis subsp. cremoris KW2	53.226	78.481	0.418
comEA	Vibrio cholerae strain A1552	62.745	64.557	0.405
comEA	Vibrio cholerae C6706	62.745	64.557	0.405
comEA/celA/cilE	Streptococcus pneumoniae Rx1	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae R6	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae D39	49.206	79.747	0.392
comEA/comE1	Glaesserella parasuis strain SC1401	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus mitis NCTC 12261	49.206	79.747	0.392
comEA	Acinetobacter baumannii D1279779	47.619	79.747	0.38
comEA/celA/cilE	Streptococcus mitis SK321	47.619	79.747	0.38
comE1/comEA	Haemophilus influenzae Rd KW20	50.847	74.684	0.38
comEA	Acinetobacter baumannii strain A118	46.032	79.747	0.367
comEA	Vibrio campbellii strain DS40M4	48.333	75.949	0.367

References

• [1]: Byeonghwa Jeon et al. (2007) Cj0011c, a periplasmic single- and double-stranded DNA-binding protein, contributes to natural transformation in Campylobacter jejuni. Journal of Bacteriology 189(20):7399-407. [PMID: 17693521]