Detailed information
Overview
| Name | comEA/celA/cilE | Type | Machinery gene |
| Locus tag | SP_RS04730 | Genome accession | NC_003028 |
| Coordinates | 901982..902632 (+) | Length | 216 a.a. |
| NCBI ID | WP_000387344.1 | Uniprot ID | A0A0H2UPM7 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | dsDNA binding to the cell surface DNA binding and uptake |
||
Function
ComEA is a DNA-binding protein critical for the uptake of extracellular DNA during natural transformation. It binds to double-stranded DNA (dsDNA) at the cell surface, facilitating its transport into the cell through the competence-specific DNA uptake machinery. ComEA works in concert with other proteins such as ComEC, which is involved in the transport of single-stranded DNA into the cell.
Genomic Context
Location: 896982..907632
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP_RS12760 (SP_0949) | - | 897942..898756 (+) | 815 | Protein_893 | IS5-like element IS1515 family transposase | - |
| SP_RS04705 (SP_0950) | - | 898939..899439 (+) | 501 | WP_000566988.1 | GNAT family N-acetyltransferase | - |
| SP_RS04710 (SP_0951) | - | 899442..899768 (+) | 327 | Protein_895 | TfoX/Sxy family protein | - |
| SP_RS12055 (SP_0952) | ald | 900069..901168 (-) | 1100 | Protein_896 | alanine dehydrogenase | - |
| SP_RS04725 (SP_0953) | - | 901345..901914 (+) | 570 | WP_000443750.1 | GNAT family N-acetyltransferase | - |
| SP_RS04730 (SP_0954) | comEA/celA/cilE | 901982..902632 (+) | 651 | WP_000387344.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
| SP_RS04735 (SP_0955) | comEC/celB | 902616..904856 (+) | 2241 | WP_000942394.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| SP_RS04740 (SP_0956) | - | 905035..905223 (+) | 189 | WP_001808514.1 | hypothetical protein | - |
| SP_RS04745 (SP_0957) | - | 905256..905843 (+) | 588 | WP_000939895.1 | ATP-binding cassette domain-containing protein | - |
| SP_RS04750 (SP_0958) | - | 905847..907031 (+) | 1185 | WP_000655960.1 | ABC transporter permease | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| htrA | comEA/celA/cilE | negative effect |
| htrA | comC/comC2 | negative effect |
| comC/comC2 | comD/comD2 | positive effect |
| comD/comD2 | comE | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comM | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comD/comD2 | positive effect |
| comE | comC/comC2 | positive effect |
| stkP | comE | positive effect |
| comX/comX1 | late competence genes | positive effect |
| clpP | comX/comX1 | negative effect |
| comW | comX/comX1 | positive effect |
| clpE | comX/comX1 | negative effect |
| comW | comX/comX2 | positive effect |
| clpP | comW | negative effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| comA | comC/comC2 | positive effect |
| comB | comC/comC2 | positive effect |
| comM | cbpD | negative effect |
| comX/comX2 | late competence genes | positive effect |
| clpP | comX/comX2 | negative effect |
| clpE | comX/comX2 | negative effect |
| ciaH | comC/comC2 | negative effect |
| ciaR | comC/comC2 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| ciaH | htrA | positive effect |
| htrA | comEC/celB | negative effect |
| ciaR | htrA | positive effect |
Sequence
Protein
Download Length: 216 a.a. Molecular weight: 23181.48 Da Isoelectric Point: 6.0746
MEAIIEKIKEYKIIVICTGLGLLVGGFFLLKPAPQTPVKETNLQAEVAAVSKDSSTEKEVKKEEKEEPLEQDLITVDVKG
AVKSPGIYDLPVGSRVNDAVQKAGGLTEQADSKSLNLAQKVSDEALVYVPTKGEEAVSQQTGSGTASSTSKEKKVNLNKA
SLEELKQVKGLGGKRAQDIIDHREANGKFKSVDELKKVSGIGGKTIEKLKDYVTVD
Nucleotide
Download Length: 651 bp
ATGGAAGCAATTATCGAGAAAATCAAAGAGTATAAAATCATCGTCATCTGTACTGGTCTGGGCTTGCTTGTAGGAGGATT
TTTCCTGCTAAAACCAGCTCCACAAACACCTGTCAAAGAGACGAATTTGCAGGCTGAAGTTGCAGCTGTTTCCAAGGACT
CATCGACCGAAAAGGAAGTGAAGAAGGAAGAAAAGGAAGAACCCCTTGAACAAGATCTAATCACAGTAGATGTCAAAGGT
GCTGTCAAATCGCCAGGGATTTATGACTTGCCTGTAGGTAGTCGAGTCAATGATGCTGTTCAGAAGGCTGGTGGCTTGAC
AGAGCAAGCAGACAGCAAGTCGCTCAATCTAGCTCAGAAAGTTAGTGATGAGGCTCTGGTTTACGTTCCTACTAAGGGAG
AAGAAGCAGTTAGTCAACAGACTGGTTCGGGGACAGCTTCTTCAACAAGCAAGGAAAAGAAGGTCAATCTCAACAAGGCC
AGTCTGGAAGAACTCAAGCAGGTCAAGGGACTGGGAGGAAAACGAGCTCAGGACATTATTGACCATCGTGAGGCAAATGG
CAAGTTCAAGTCAGTAGACGAGCTCAAGAAGGTCTCTGGCATTGGTGGCAAAACAATAGAAAAGCTTAAAGACTATGTTA
CAGTGGATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEA/celA/cilE | Streptococcus pneumoniae Rx1 |
97.222 |
100 |
0.972 |
| comEA/celA/cilE | Streptococcus pneumoniae R6 |
97.222 |
100 |
0.972 |
| comEA/celA/cilE | Streptococcus pneumoniae D39 |
97.222 |
100 |
0.972 |
| comEA/celA/cilE | Streptococcus mitis NCTC 12261 |
96.759 |
100 |
0.968 |
| comEA/celA/cilE | Streptococcus mitis SK321 |
93.056 |
100 |
0.931 |
| comEA | Lactococcus lactis subsp. cremoris KW2 |
42.291 |
100 |
0.44 |
| Cj0011c | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
49.206 |
79.747 |
0.392 |
| comEA | Streptococcus thermophilus LMD-9 |
39.035 |
98.701 |
0.385 |
| comEA | Latilactobacillus sakei subsp. sakei 23K |
34.335 |
100 |
0.37 |
Multiple sequence alignment
References
| [1] | Yanni Liu et al. (2019) HtrA-mediated selective degradation of DNA uptake apparatus accelerates termination of pneumococcal transformation. Molecular Microbiology 112(4):1308-1325. [PMID: 31396996] |
| [2] | Matthieu J Bergé et al. (2013) Midcell recruitment of the DNA uptake and virulence nuclease, EndA, for pneumococcal transformation. PLoS Pathogens 9(9):e1003596. [PMID: 24039578] |
| [3] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [4] | Mathieu Bergé et al. (2002) Uptake of transforming DNA in Gram-positive bacteria: a view from Streptococcus pneumoniae. Molecular Microbiology 45(2):411-21. [PMID: 12123453] |
| [5] | E V Pestova et al. (1998) Isolation and characterization of three Streptococcus pneumoniae transformation-specific loci by use of a lacZ reporter insertion vector. Journal of Bacteriology 180(10):2701-10. [PMID: 9573156] |