Detailed information
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | SP_RS10155 | Genome accession | NC_003028 |
| Coordinates | 1914134..1914613 (-) | Length | 159 a.a. |
| NCBI ID | WP_000588925.1 | Uniprot ID | A0AAX3HEV8 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | activate transcription of late competence genes Competence regulation |
||
Genomic Context
Location: 1909134..1919613
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP_RS10155 (SP_2006) | comX/comX2 | 1914134..1914613 (-) | 480 | WP_000588925.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| SP_RS10160 (SP_2007) | nusG | 1914735..1915271 (-) | 537 | WP_000376736.1 | transcription termination/antitermination protein NusG | - |
| SP_RS10165 (SP_2008) | secE | 1915326..1915502 (-) | 177 | WP_001210991.1 | preprotein translocase subunit SecE | - |
| SP_RS10170 (SP_2009) | rpmG | 1915512..1915664 (-) | 153 | WP_001809950.1 | 50S ribosomal protein L33 | - |
| SP_RS10175 (SP_2010) | pbp2a | 1915717..1917912 (-) | 2196 | WP_000762628.1 | penicillin-binding protein PBP2A | - |
| SP_RS10180 (SP_2011) | - | 1917999..1918874 (+) | 876 | WP_001160819.1 | RluA family pseudouridine synthase | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comX/comX2 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| comE | comX/comX2 | positive effect |
| clpP | comX/comX2 | negative effect |
| comW | comX/comX2 | positive effect |
| clpE | comX/comX2 | negative effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comE | comX/comX1 | positive effect |
| clpP | comX/comX1 | negative effect |
| comW | comX/comX1 | positive effect |
| clpE | comX/comX1 | negative effect |
| comE | comE | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comM | positive effect |
| comE | comD/comD2 | positive effect |
| comE | comC/comC2 | positive effect |
| comD/comD2 | comE | positive effect |
| stkP | comE | positive effect |
| clpP | comW | negative effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| comA | comC/comC2 | positive effect |
| comB | comC/comC2 | positive effect |
| comM | cbpD | negative effect |
| comC/comC2 | comD/comD2 | positive effect |
| ciaH | comC/comC2 | negative effect |
| htrA | comC/comC2 | negative effect |
| ciaR | comC/comC2 | negative effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| ciaH | htrA | positive effect |
| htrA | comEC/celB | negative effect |
| htrA | comEA/celA/cilE | negative effect |
| ciaR | htrA | positive effect |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19887.54 Da Isoelectric Point: 7.3798
>NTDB_id=141 SP_RS10155 WP_000588925.1 1914134..1914613(-) (comX/comX2) [Streptococcus pneumoniae TIGR4]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWEQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWEQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=141 SP_RS10155 WP_000588925.1 1914134..1914613(-) (comX/comX2) [Streptococcus pneumoniae TIGR4]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGAGCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAGACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAACAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGAGCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAGACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAACAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
References
| [1] | Andrew Piotrowski et al. (2009) Competence for genetic transformation in Streptococcus pneumoniae: termination of activity of the alternative sigma factor ComX is independent of proteolysis of ComX and ComW. Journal of Bacteriology 191(10):3359-66. [PMID: 19286798] |
| [2] | Chang Kyoo Sung et al. (2005) Two distinct functions of ComW in stabilization and activation of the alternative sigma factor ComX in Streptococcus pneumoniae. Journal of Bacteriology 187(9):3052-61. [PMID: 15838032] |
| [3] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [4] | Ping Luo et al. (2003) Transient association of an alternative sigma factor, ComX, with RNA polymerase during the period of competence for genetic transformation in Streptococcus pneumoniae. Journal of Bacteriology 185(1):349-58. [PMID: 12486073] |
| [5] | Ping Luo et al. (2003) ComX is a unique link between multiple quorum sensing outputs and competence in Streptococcus pneumoniae. Molecular Microbiology 50(2):623-33. [PMID: 14617184] |
| [6] | M S Lee et al. (1999) Identification of a new regulator in Streptococcus pneumoniae linking quorum sensing to competence for genetic transformation. Journal of Bacteriology 181(16):5004-16. [PMID: 10438773] |
| [7] | E A Campbell et al. (1998) A competence regulon in Streptococcus pneumoniae revealed by genomic analysis. Molecular Microbiology 27(5):929-39. [PMID: 9535083] |