Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | SP_RS00130 | Genome accession | NC_003028 |
| Coordinates | 22365..22601 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | stabilization and activation of ComX Competence regulation |
||
Function
ComW is essential for the induction of late competence genes and contributes to the stabilization and full activity of the alternative sigma factor σX encoded by comX. σX is required for the transcription of genes involved in DNA uptake and recombination. ComW facilitates the assembly of the RNA polymerase-σX holoenzyme, promoting transcription from σX-targeted promoters. It also protects σX from degradation by the ClpP protease, ensuring sufficient levels of σX for the expression of late competence genes.
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IScluster/Tn | 20422..22048 | 22365..22601 | flank | 317 |
Gene organization within MGE regions
Location: 20422..22601
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP_RS11515 | - | 20422..21267 (+) | 846 | Protein_14 | IS630-like element IS630-Spn1 family transposase | - |
| SP_RS11520 (SP_0017) | - | 21302..22099 (-) | 798 | Protein_15 | transposase | - |
| SP_RS00130 (SP_0018) | comW | 22365..22601 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comW | comX/comX1 | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comM | positive effect |
| comE | comD/comD2 | positive effect |
| comE | comC/comC2 | positive effect |
| comD/comD2 | comE | positive effect |
| stkP | comE | positive effect |
| clpP | comX/comX2 | negative effect |
| clpP | comX/comX1 | negative effect |
| clpP | comW | negative effect |
| comW | comX/comX2 | positive effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| clpE | comX/comX2 | negative effect |
| clpE | comX/comX1 | negative effect |
| comA | comC/comC2 | positive effect |
| comB | comC/comC2 | positive effect |
| comM | cbpD | negative effect |
| comC/comC2 | comD/comD2 | positive effect |
| ciaH | comC/comC2 | negative effect |
| htrA | comC/comC2 | negative effect |
| ciaR | comC/comC2 | negative effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| ciaH | htrA | positive effect |
| htrA | comEC/celB | negative effect |
| htrA | comEA/celA/cilE | negative effect |
| ciaR | htrA | positive effect |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
100 |
0.753 |
Multiple sequence alignment
References
| [1] | Nicole L Inniss et al. (2019) The pneumococcal σX activator, ComW, is a DNA-binding protein critical for natural transformation. The Journal of Biological Chemistry 294(29):11101-11118. [PMID: 31160340] |
| [2] | Yanina Tovpeko et al. (2016) Competence for Genetic Transformation in Streptococcus pneumoniae: Mutations in σA Bypass the ComW Requirement for Late Gene Expression. Journal of Bacteriology 198(17):2370-8. [PMID: 27353650] |
| [3] | Yanina Tovpeko et al. (2014) Competence for genetic transformation in Streptococcus pneumoniae: mutations in σA bypass the comW requirement. Journal of Bacteriology 196(21):3724-34. [PMID: 25112479] |
| [4] | Andrew Piotrowski et al. (2009) Competence for genetic transformation in Streptococcus pneumoniae: termination of activity of the alternative sigma factor ComX is independent of proteolysis of ComX and ComW. Journal of Bacteriology 191(10):3359-66. [PMID: 19286798] |
| [5] | Chang Kyoo Sung et al. (2005) Two distinct functions of ComW in stabilization and activation of the alternative sigma factor ComX in Streptococcus pneumoniae. Journal of Bacteriology 187(9):3052-61. [PMID: 15838032] |
| [6] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [7] | Ping Luo et al. (2004) Identification of ComW as a new component in the regulation of genetic transformation in Streptococcus pneumoniae. Molecular Microbiology 54(1):172-83. [PMID: 15458414] |