Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | SM12261_RS00100 | Genome accession | NZ_CP028414 |
| Coordinates | 20603..20836 (+) | Length | 77 a.a. |
| NCBI ID | WP_000941923.1 | Uniprot ID | - |
| Organism | Streptococcus mitis NCTC 12261 | ||
| Function | stabilization and activation of ComX Competence regulation |
||
Genomic Context
Location: 15603..25836
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SM12261_RS00100 (SM12261_0022) | comW | 20603..20836 (+) | 234 | WP_000941923.1 | sigma(X)-activator ComW | Regulator |
| SM12261_RS00105 (SM12261_0023) | - | 21070..22356 (+) | 1287 | WP_025169748.1 | adenylosuccinate synthase | - |
| SM12261_RS00110 (SM12261_0024) | tadA | 22556..23023 (+) | 468 | WP_001110112.1 | tRNA adenosine(34) deaminase TadA | - |
| SM12261_RS00120 (SM12261_0025) | - | 23210..23653 (+) | 444 | WP_000702005.1 | dUTP diphosphatase | - |
| SM12261_RS00125 (SM12261_0026) | - | 23613..24170 (+) | 558 | WP_000863561.1 | histidine phosphatase family protein | - |
| SM12261_RS00130 (SM12261_0027) | radA | 24184..25545 (+) | 1362 | WP_078228442.1 | DNA repair protein RadA | Machinery gene |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comW | comX/sigX/comX1/sigX1 | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comE | comX/sigX/comX2/sigX2 | positive effect |
| comE | comD | positive effect |
| comE | comE | positive effect |
| comE | comX/sigX/comX1/sigX1 | positive effect |
| comE | comB | positive effect |
| comE | comC | positive effect |
| comE | comM | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comD | comE | positive effect |
| comW | comX/sigX/comX2/sigX2 | positive effect |
| comC | comD | positive effect |
| comB | comC | positive effect |
| comA | comC | positive effect |
| comM | cbpD | negative effect |
Sequence
Protein
Download Length: 77 a.a. Molecular weight: 9779.36 Da Isoelectric Point: 6.8760
>NTDB_id=491 SM12261_RS00100 WP_000941923.1 20603..20836(+) (comW) [Streptococcus mitis NCTC 12261]
MLQSIYDQMMDFYRNIEEEYGMFLGDNFDWEHVHFKFLIYYLVRYRIVSHRDFIVYHYRVAYRLYLEKLIMKQGFVA
MLQSIYDQMMDFYRNIEEEYGMFLGDNFDWEHVHFKFLIYYLVRYRIVSHRDFIVYHYRVAYRLYLEKLIMKQGFVA
Nucleotide
Download Length: 234 bp
>NTDB_id=491 SM12261_RS00100 WP_000941923.1 20603..20836(+) (comW) [Streptococcus mitis NCTC 12261]
ATGCTACAAAGTATTTATGATCAGATGATGGATTTTTATAGAAATATTGAAGAAGAGTATGGTATGTTCTTGGGTGATAA
TTTTGATTGGGAACATGTTCATTTTAAGTTTTTGATTTATTATCTTGTCCGATATCGTATTGTGAGTCATCGGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGATAATGAAACAGGGTTTTGTTGCTTGA
ATGCTACAAAGTATTTATGATCAGATGATGGATTTTTATAGAAATATTGAAGAAGAGTATGGTATGTTCTTGGGTGATAA
TTTTGATTGGGAACATGTTCATTTTAAGTTTTTGATTTATTATCTTGTCCGATATCGTATTGTGAGTCATCGGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGATAATGAAACAGGGTTTTGTTGCTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus mitis SK321 |
97.403 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
75.325 |
100 |
0.753 |
| comW | Streptococcus pneumoniae D39 |
75.325 |
100 |
0.753 |
| comW | Streptococcus pneumoniae Rx1 |
75.325 |
100 |
0.753 |
| comW | Streptococcus pneumoniae TIGR4 |
75.325 |
100 |
0.753 |
Multiple sequence alignment
References
| [1] | G Salvadori et al. (2018) High-resolution profiles of the Streptococcus mitis CSP signaling pathway reveal core and strain-specific regulated genes. BMC Genomics 19(1):453. [PMID: 29898666] |