Detailed information    

experimental Experimentally validated

Overview


Name   comW   Type   Regulator
Locus tag   SPR_RS00110 Genome accession   NC_003098
Coordinates   22168..22404 (+) Length   78 a.a.
NCBI ID   WP_000939545.1    Uniprot ID   A0A0H2ZMA7
Organism   Streptococcus pneumoniae R6     
Function   stabilization and activation of ComX   
Competence regulation

Function


ComW is essential for the induction of late competence genes and contributes to the stabilization and full activity of the alternative sigma factor σX encoded by comX. σX is required for the transcription of genes involved in DNA uptake and recombination. ComW facilitates the assembly of the RNA polymerase-σX holoenzyme, promoting transcription from σX-targeted promoters. It also protects σX from degradation by the ClpP protease, ensuring sufficient levels of σX for the expression of late competence genes.


Genomic Context


Location: 17168..27404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPR_RS00100 - 20225..21071 (+) 847 Protein_14 IS630 family transposase -
  SPR_RS00105 - 21106..21902 (-) 797 Protein_15 transposase -
  SPR_RS00110 (spr0020) comW 22168..22404 (+) 237 WP_000939545.1 sigma(X)-activator ComW Regulator
  SPR_RS00115 (spr0021) - 22635..23921 (+) 1287 WP_000205044.1 adenylosuccinate synthase -
  SPR_RS00120 (spr0022) tadA 24122..24589 (+) 468 WP_000291874.1 tRNA adenosine(34) deaminase TadA -
  SPR_RS00130 (spr0023) - 24776..25219 (+) 444 WP_000701992.1 dUTP diphosphatase -
  SPR_RS00135 (spr0024) - 25221..25736 (+) 516 WP_000691236.1 histidine phosphatase family protein -
  SPR_RS00140 (spr0025) radA 25750..27111 (+) 1362 WP_074017595.1 DNA repair protein RadA Machinery gene

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comW comX/comX1 positive effect
  comX/comX1 late competence genes positive effect
  comX/comX2 late competence genes positive effect
  comX/comX1 late competence genes positive effect
  comX/comX2 late competence genes positive effect
  clpE comX/comX2 negative effect
  clpE comX/comX1 negative effect
  clpP comX/comX2 negative effect
  clpP comX/comX1 negative effect
  clpP comW negative effect
  comW comX/comX2 positive effect
  mecA comW negative effect
  clpC comW negative effect
  comE comW positive effect
  comE comX/comX2 positive effect
  comE comB positive effect
  comE comC/comC1 positive effect
  comE comX/comX1 positive effect
  comE comA positive effect
  comE comD/comD1 positive effect
  comE comM positive effect
  comE comE positive effect
  comD/comD1 comE positive effect
  stkP comE positive effect
  comB comC/comC1 positive effect
  comC/comC1 comD/comD1 positive effect
  comA comC/comC1 positive effect
  ccnD comC/comC1 negative effect
  ccnC comC/comC1 negative effect
  ccnE comC/comC1 negative effect
  htrA comC/comC1 negative effect
  ciaR comC/comC1 negative effect
  ccnA comC/comC1 negative effect
  ciaH comC/comC1 negative effect
  ccnB comC/comC1 negative effect
  comM cbpD negative effect
  htrA comEA/celA/cilE negative effect
  htrA comEC/celB negative effect
  ciaH htrA positive effect
  ciaR htrA positive effect
  cbpD lytC positive effect
  cbpD lytA positive effect

Sequence


Protein


Download         Length: 78 a.a.        Molecular weight: 9658.13 Da        Isoelectric Point: 6.7051

>NTDB_id=179 SPR_RS00110 WP_000939545.1 22168..22404(+) (comW) [Streptococcus pneumoniae R6]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=179 SPR_RS00110 WP_000939545.1 22168..22404(+) (comW) [Streptococcus pneumoniae R6]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2ZMA7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comW Streptococcus pneumoniae TIGR4

100

100

1

  comW Streptococcus pneumoniae D39

100

100

1

  comW Streptococcus pneumoniae Rx1

100

100

1

  comW Streptococcus mitis SK321

75.641

100

0.756

  comW Streptococcus mitis NCTC 12261

75.325

100

0.753


Multiple sequence alignment    



References


[1] Nicole L Inniss et al. (2019) The pneumococcal σX activator, ComW, is a DNA-binding protein critical for natural transformation. The Journal of Biological Chemistry 294(29):11101-11118. [PMID: 31160340]
[2] Yanina Tovpeko et al. (2016) Competence for Genetic Transformation in Streptococcus pneumoniae: Mutations in σA Bypass the ComW Requirement for Late Gene Expression. Journal of Bacteriology 198(17):2370-8. [PMID: 27353650]
[3] Yanina Tovpeko et al. (2014) Competence for genetic transformation in Streptococcus pneumoniae: mutations in σA bypass the comW requirement. Journal of Bacteriology 196(21):3724-34. [PMID: 25112479]
[4] Andrew Piotrowski et al. (2009) Competence for genetic transformation in Streptococcus pneumoniae: termination of activity of the alternative sigma factor ComX is independent of proteolysis of ComX and ComW. Journal of Bacteriology 191(10):3359-66. [PMID: 19286798]
[5] Chang Kyoo Sung et al. (2005) Two distinct functions of ComW in stabilization and activation of the alternative sigma factor ComX in Streptococcus pneumoniae. Journal of Bacteriology 187(9):3052-61. [PMID: 15838032]
[6] Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980]
[7] Ping Luo et al. (2004) Identification of ComW as a new component in the regulation of genetic transformation in Streptococcus pneumoniae. Molecular Microbiology 54(1):172-83. [PMID: 15458414]