Detailed information NTG0000485

Experimentally validated

Overview

• Name: comC
• Type: Regulator
• Locus tag: SM12261_RS09380
• Genome accession: NZ_CP028414
• Coordinates: 1865725..1865847 (-)
• Length: 40 a.a.
• NCBI ID: WP_004238992.1
• Uniprot ID: O33675
• Organism: Streptococcus mitis NCTC 12261
• Function: binding to ComD; induce autophosphorylation of ComD Competence regulation

Function

Comparison of the global transcriptome in response to CSP shows the conservation of the ComE and SigX-core regulons in competent S. mitis isolates, as well as species and strain-specific genes.

Genomic Context

Location: 1860725..1870847

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SM12261_RS09355 (SM12261_1805)	-	1862853..1863395 (+)	543	WP_001158274.1	TetR/AcrR family transcriptional regulator	-
SM12261_RS09370 (SM12261_1808)	comE	1863638..1864390 (-)	753	WP_000866073.1	competence system response regulator transcription factor ComE	Regulator
SM12261_RS09375 (SM12261_1809)	comD	1864387..1865712 (-)	1326	WP_020902616.1	competence system sensor histidine kinase ComD	Regulator
SM12261_RS09380 (SM12261_1810)	comC	1865725..1865847 (-)	123	WP_004238992.1	competence-stimulating peptide ComC	Regulator
SM12261_RS09390 (SM12261_1812)	rlmH	1866130..1866609 (-)	480	WP_000695934.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
SM12261_RS09395 (SM12261_1813)	htrA	1866792..1867973 (+)	1182	WP_000681587.1	S1C family serine protease	Regulator
SM12261_RS09400 (SM12261_1814)	spo0J	1868031..1868789 (+)	759	WP_000410370.1	ParB/RepB/Spo0J family partition protein	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comC	comD	positive effect
comD	comE	positive effect
comE	comX/sigX/comX2/sigX2	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comE	comD	positive effect
comE	comE	positive effect
comE	comX/sigX/comX1/sigX1	positive effect
comE	comB	positive effect
comE	comC	positive effect
comE	comM	positive effect
comE	comW	positive effect
comE	comA	positive effect
comW	comX/sigX/comX2/sigX2	positive effect
comW	comX/sigX/comX1/sigX1	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comB	comC	positive effect
comA	comC	positive effect
comM	cbpD	negative effect

Sequence

Protein

• Length: 40 a.a.
• Molecular weight: 4897.64 Da
• Isoelectric Point: 10.6104

>NTDB_id=485 SM12261_RS09380 WP_004238992.1 1865725..1865847(-) (comC) [Streptococcus mitis NCTC 12261]
MKNTVNLDKFVELKEKDLQNIQGGEIRQTHNIFFNFFKRR

Nucleotide

• Length: 123 bp

>NTDB_id=485 SM12261_RS09380 WP_004238992.1 1865725..1865847(-) (comC) [Streptococcus mitis NCTC 12261]
ATGAAAAACACAGTTAATTTAGATAAGTTTGTAGAATTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATAAG
GCAAACACATAATATTTTCTTTAATTTCTTTAAAAGAAGATAA

CSP

This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:

EIRQTHNIFFNFFKRR

Domains

Predicted by InterproScan.

• COMC family (ComC) (1-27)

3D structure

• AlphaFold DB: O33675

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comC	Streptococcus mitis SK321	66.667	90	0.6
comC/comC2	Streptococcus pneumoniae TIGR4	57.5	100	0.575
comC/comC2	Streptococcus pneumoniae A66	57.5	100	0.575
comC/comC1	Streptococcus pneumoniae R6	74.074	67.5	0.5
comC/comC1	Streptococcus pneumoniae G54	74.074	67.5	0.5
comC/comC1	Streptococcus pneumoniae Rx1	74.074	67.5	0.5
comC/comC1	Streptococcus pneumoniae D39	74.074	67.5	0.5

References

• [1]: Tahmina A Milly et al. (2023) Developing multispecies quorum-sensing modulators based on the Streptococcus mitis competence-stimulating peptide. The Journal of Biological Chemistry 299(12):105448. [PMID: 37951305]
• [2]: Tahmina Ahmed Milly et al. (2020) Biological Evaluation of Native Streptococcal Competence Stimulating Peptides Reveal Potential Crosstalk Between Streptococcus mitis and Streptococcus pneumoniae and a New Scaffold for the Development of S. pneumoniae Quorum Sensing Modulators. RSC Chemical Biology 1(2):60-67. [PMID: 32905481]
• [3]: G Salvadori et al. (2018) High-resolution profiles of the Streptococcus mitis CSP signaling pathway reveal core and strain-specific regulated genes. BMC Genomics 19(1):453. [PMID: 29898666]