Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | KZH43_RS10255 | Genome accession | NZ_CP079923 |
| Coordinates | 2026908..2027033 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae Rx1 | ||
| Function | binding to ComD; induce autophosphorylation of ComD Competence regulation |
||
Function
The comC gene encodes the precursor of the competence-stimulating peptide (CSP), which is processed and secreted by the ComAB transporter. CSP accumulates in the extracellular environment and binds to the histidine kinase ComD, triggering a signaling cascade that activates the expression of competence genes. This process is essential for the induction of the competent state, enabling the bacterium to perform natural transformation. Two major allelic variants of the comC gene have been identified in S. pneumoniae: comC1 and comC2. These variants result in the production of two distinct CSPs, CSP1 and CSP2. Each CSP variant identifies a specific pherotype, and strains carrying one variant are typically unable to respond to the other CSP variant due to receptor specificity.
Genomic Context
Location: 2021908..2032033
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZH43_RS10885 | - | 2022246..2023849 (-) | 1604 | Protein_2008 | YhgE/Pip family protein | - |
| KZH43_RS10230 (KZH43_10225) | - | 2024028..2024570 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| KZH43_RS10245 (KZH43_10240) | comE | 2024813..2025565 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| KZH43_RS10250 (KZH43_10245) | comD/comD1 | 2025562..2026887 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| KZH43_RS10255 (KZH43_10250) | comC/comC1 | 2026908..2027033 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| KZH43_RS10265 (KZH43_10260) | rlmH | 2027315..2027794 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| KZH43_RS10270 (KZH43_10265) | htrA | 2027977..2029158 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| KZH43_RS10275 (KZH43_10270) | spo0J | 2029216..2029974 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comC/comC1 | comD/comD1 | positive effect |
| comD/comD1 | comE | positive effect |
| comE | comA | positive effect |
| comA | comC/comC1 | positive effect |
| comE | comB | positive effect |
| comE | comE | positive effect |
| comE | comC/comC1 | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comD/comD1 | positive effect |
| comE | comM | positive effect |
| comE | comW | positive effect |
| stkP | comE | positive effect |
| comB | comC/comC1 | positive effect |
| ciaR | comC/comC1 | negative effect |
| ciaH | comC/comC1 | negative effect |
| htrA | comC/comC1 | negative effect |
| ciaR | htrA | positive effect |
| htrA | comEA/celA/cilE | negative effect |
| htrA | comEC/celB | negative effect |
| ciaH | htrA | positive effect |
| comX/comX1 | late competence genes | positive effect |
| comW | comX/comX1 | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| comW | comX/comX2 | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| comM | cbpD | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| mecA | comW | negative effect |
| comX/comX1 | late competence genes | positive effect |
| comX/comX2 | late competence genes | positive effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
CSP
This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
67.5 |
0.5 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |
Multiple sequence alignment
References
| [1] | Tahmina A Milly et al. (2021) Harnessing Multiple, Nonproteogenic Substitutions to Optimize CSP:ComD Hydrophobic Interactions in Group 1 Streptococcus pneumoniae. Chembiochem : A European Journal of Chemical Biology 22(11):1940-1947. [PMID: 33644965] |
| [2] | Yifang Yang et al. (2019) Exploring the competence stimulating peptide (CSP) N-terminal requirements for effective ComD receptor activation in group1 Streptococcus pneumoniae. Bioorganic Chemistry 89:102987. [PMID: 31132605] |
| [3] | Bimal Koirala et al. (2019) Unveiling the Importance of Amide Protons in CSP:ComD Interactions in Streptococcus pneumoniae. ACS Medicinal Chemistry Letters 10(6):880-886. [PMID: 31223442] |
| [4] | Bimal Koirala et al. (2018) Defining the hydrophobic interactions that drive competence stimulating peptide (CSP)-ComD binding in Streptococcus pneumoniae. Beilstein Journal of Organic Chemistry 14:1769-1777. [PMID: 30112082] |
| [5] | Yifang Yang et al. (2017) Structure-Activity Relationships of the Competence Stimulating Peptides (CSPs) in Streptococcus pneumoniae Reveal Motifs Critical for Intra-group and Cross-group ComD Receptor Activation. ACS Chemical Biology 12(4):1141-1151. [PMID: 28221753] |
| [6] | M Ramirez et al. (1997) Ubiquitous distribution of the competence related genes comA and comC among isolates of Streptococcus pneumoniae. Microbial Drug Resistance (Larchmont, N.Y.) 3(1):39-52. [PMID: 9109095] |
| [7] | G Pozzi et al. (1996) Competence for genetic transformation in encapsulated strains of Streptococcus pneumoniae: two allelic variants of the peptide pheromone. Journal of Bacteriology 178(20):6087-90. [PMID: 8830714] |
| [8] | L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047] |