Detailed information NTG0000513

Experimentally validated

Overview

• Name: comC
• Type: Regulator
• Locus tag: SMSK321_RS0102900
• Genome accession: NZ_AEDT01000032
• Coordinates: 235269..235394 (-)
• Length: 41 a.a.
• NCBI ID: WP_000799685.1
• Uniprot ID: A0A081PPH5
• Organism: Streptococcus mitis SK321
• Function: binding to ComD; induce autophosphorylation of ComD Competence regulation

Function

Comparison of the global transcriptome in response to CSP shows the conservation of the ComE and SigX-core regulons in competent S. mitis isolates, as well as species and strain-specific genes.

Genomic Context

Location: 230269..240394

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMSK321_RS10610 (SMSK321_1633)	-	232389..232931 (+)	543	WP_001158273.1	TetR/AcrR family transcriptional regulator	-
SMSK321_RS0102895	comE	233174..233926 (-)	753	WP_000866074.1	competence system response regulator transcription factor ComE	Regulator
SMSK321_RS10615 (SMSK321_1634)	comD	233923..235248 (-)	1326	WP_001048129.1	competence system sensor histidine kinase ComD	Regulator
SMSK321_RS0102900	comC	235269..235394 (-)	126	WP_000799685.1	competence-stimulating peptide ComC	Regulator
SMSK321_RS10620 (SMSK321_1635)	rlmH	235677..236156 (-)	480	WP_000695928.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
SMSK321_RS10625 (SMSK321_1636)	htrA	236340..237521 (+)	1182	WP_000681589.1	S1C family serine protease	Regulator
SMSK321_RS10630 (SMSK321_1637)	spo0J	237579..238337 (+)	759	WP_000410371.1	ParB/RepB/Spo0J family partition protein	Regulator
SMSK321_RS10635 (SMSK321_1638)	dnaA	238551..239912 (+)	1362	WP_000660604.1	chromosomal replication initiator protein DnaA	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comC	comD	positive effect
comD	comE	positive effect
comE	comE	positive effect
comE	comM	positive effect
comE	comX/sigX/comX1/sigX1	positive effect
comE	comC	positive effect
comE	comD	positive effect
comE	comA	positive effect
comE	comX/sigX/comX2/sigX2	positive effect
comE	comW	positive effect
comE	comB	positive effect
comM	cbpD	negative effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comW	comX/sigX/comX1/sigX1	positive effect
comB	comC	positive effect
comA	comC	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comW	comX/sigX/comX2/sigX2	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect

Sequence

Protein

• Length: 41 a.a.
• Molecular weight: 4906.81 Da
• Isoelectric Point: 10.6642

>NTDB_id=513 SMSK321_RS0102900 WP_000799685.1 235269..235394(-) (comC) [Streptococcus mitis SK321]
MKNTVKLEQFVALKEKDLQEIQGGESRLPKIRFDFIFPRKK

Nucleotide

• Length: 126 bp

>NTDB_id=513 SMSK321_RS0102900 WP_000799685.1 235269..235394(-) (comC) [Streptococcus mitis SK321]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTCAAGGTGGGGAAAGTAG
ACTTCCAAAAATCCGCTTTGATTTTATTTTCCCACGAAAAAAGTAA

CSP

This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:

ESRLPKIRFDFIFPRKK

Domains

Predicted by InterproScan.

• COMC family (ComC) (1-29)

3D structure

• AlphaFold DB: A0A081PPH5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comC/comC1	Streptococcus pneumoniae D39	78.049	100	0.78
comC/comC1	Streptococcus pneumoniae Rx1	78.049	100	0.78
comC/comC1	Streptococcus pneumoniae G54	78.049	100	0.78
comC/comC1	Streptococcus pneumoniae R6	78.049	100	0.78
comC/comC2	Streptococcus pneumoniae A66	75.61	100	0.756
comC/comC2	Streptococcus pneumoniae TIGR4	75.61	100	0.756
comC	Streptococcus mitis NCTC 12261	66.667	90	0.6
comC/comC1	Streptococcus gordonii str. Challis substr. CH1	43.243	90.244	0.39

References

• [1]: Tahmina Ahmed Milly et al. (2020) Biological Evaluation of Native Streptococcal Competence Stimulating Peptides Reveal Potential Crosstalk Between Streptococcus mitis and Streptococcus pneumoniae and a New Scaffold for the Development of S. pneumoniae Quorum Sensing Modulators. RSC Chemical Biology 1(2):60-67. [PMID: 32905481]
• [2]: G Salvadori et al. (2018) High-resolution profiles of the Streptococcus mitis CSP signaling pathway reveal core and strain-specific regulated genes. BMC Genomics 19(1):453. [PMID: 29898666]