Detailed information    

experimental Experimentally validated

Overview

Name   comC/comC1   Type   Regulator
Locus tag   SGO_RS10510 Genome accession   NC_009785
Coordinates   2193491..2193643 (-) Length   50 a.a.
NCBI ID   WP_012131079.1    Uniprot ID   -
Organism   Streptococcus gordonii str. Challis substr. CH1     
Function   binding to ComD; induce autophosphorylation of ComD   
Competence regulation

Function

In S. gordonii, pre-CSP is a 50 aa polypeptide that is cleaved at a double glycine to generate the mature 19 aa residue CSP. This peptide is then exported out of the cell via an ABC-binding cassette transporter encoded by comA and comB. Once a critical concentration of environmental CSP is reached, it is detected by the two-component system ComDE, comprising a membrane-bound histidine kinase (ComD), which phosphorylates the intracellular response regulator ComE. ComE activates a signalling cascade that includes upregulation of the master regulator SigX (designated ComR in S. gordonii), an alternate sigma factor that controls expression of late competence genes encoding DNA uptake and recombination machinery.


Genomic Context

Location: 2188491..2198643
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SGO_RS10480 (SGO_2141) pth 2189270..2189839 (-) 570 WP_012131076.1 aminoacyl-tRNA hydrolase -
  SGO_RS10485 (SGO_2142) ychF 2189913..2191028 (-) 1116 WP_012131077.1 redox-regulated ATPase YchF -
  SGO_RS10500 (SGO_2145) comE/comE1 2191350..2192117 (-) 768 WP_008808031.1 competence system response regulator transcription factor ComE Regulator
  SGO_RS10505 (SGO_2146) comD/comD1 2192114..2193475 (-) 1362 WP_012131078.1 competence system sensor histidine kinase ComD Regulator
  SGO_RS10510 (SGO_2147) comC/comC1 2193491..2193643 (-) 153 WP_012131079.1 bacteriocin Regulator
  SGO_RS10520 (SGO_2149) rlmH 2193929..2194408 (-) 480 WP_012131080.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  SGO_RS10525 (SGO_2150) htrA 2194602..2195795 (+) 1194 WP_012131081.1 S1C family serine protease Regulator
  SGO_RS10530 (SGO_2151) spo0J 2195861..2196625 (+) 765 WP_012131082.1 ParB/RepB/Spo0J family partition protein Regulator

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comC/comC1 comD/comD1 positive effect
  comD/comD1 comE/comE1 positive effect
  comE/comE1 comA positive effect
  comA comC/comC1 positive effect
  comE/comE1 comB positive effect
  comE/comE1 comR/comR2 positive effect
  comE/comE1 comE/comE1 positive effect
  comE/comE1 comC/comC1 positive effect
  comE/comE1 comR/comR1 positive effect
  comE/comE1 comD/comD1 positive effect
  comB comC/comC1 positive effect
  comR/comR2 late competence genes positive effect
  comR/comR1 late competence genes positive effect
  comR/comR2 late competence genes positive effect
  comR/comR1 late competence genes positive effect

Sequence

Protein


Download         Length: 50 a.a.        Molecular weight: 6146.21 Da        Isoelectric Point: 10.8831

>NTDB_id=415 SGO_RS10510 WP_012131079.1 2193491..2193643(-) (comC/comC1) [Streptococcus gordonii str. Challis substr. CH1]
MKKKNKQNLLPKELQQFEILTERKLEQVTGGDVRSNKIRLWWENIFFNKK

Nucleotide


Download         Length: 153 bp        

>NTDB_id=415 SGO_RS10510 WP_012131079.1 2193491..2193643(-) (comC/comC1) [Streptococcus gordonii str. Challis substr. CH1]
ATGAAAAAGAAAAACAAACAAAATCTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGAAAGAAAATTAGAGCA
AGTTACTGGTGGAGATGTTCGCTCAAACAAAATTAGATTATGGTGGGAAAATATATTCTTTAATAAAAAATAA

CSP

This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:

DVRSNKIRLWWENIFFNKK


Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC2 Streptococcus gordonii strain NCTC7865

74

100

0.74
  comC Streptococcus mitis SK321

43.243

90.244

0.39

Multiple sequence alignment    



References

[1] Alison A Jack et al. (2015) Streptococcus gordonii comCDE (competence) operon modulates biofilm formation with Candida albicans. Microbiology (Reading, England) 161(Pt 2):411-421. [PMID: 25505189]
[2] Nicholas C K Heng et al. (2007) Competence-dependent bacteriocin production by Streptococcus gordonii DL1 (Challis). Journal of Bacteriology 189(4):1468-72. [PMID: 17012395]
[3] M M Vickerman et al. (2007) Genome-wide transcriptional changes in Streptococcus gordonii in response to competence signaling peptide. Journal of Bacteriology 189(21):7799-807. [PMID: 17720781]
[4] R D Lunsford et al. (1996) Natural genetic transformation in Streptococcus gordonii: comX imparts spontaneous competence on strain wicky. Journal of Bacteriology 178(19):5831-5. [PMID: 8824638]
[5] L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047]