Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | DQL23_RS10750 | Genome accession | NZ_LS483341 |
| Coordinates | 2184273..2184425 (-) | Length | 50 a.a. |
| NCBI ID | WP_008808033.1 | Uniprot ID | P72443 |
| Organism | Streptococcus gordonii strain NCTC7865 | ||
| Function | binding to ComD; induce autophosphorylation of ComD Competence regulation |
||
Function
In S. gordonii, pre-CSP is a 50 aa polypeptide that is cleaved at a double glycine to generate the mature 19 aa residue CSP. This peptide is then exported out of the cell via an ABC-binding cassette transporter encoded by comA and comB. Once a critical concentration of environmental CSP is reached, it is detected by the two-component system ComDE, comprising a membrane-bound histidine kinase (ComD), which phosphorylates the intracellular response regulator ComE. ComE activates a signalling cascade that includes upregulation of the master regulator SigX (designated ComR in S. gordonii), an alternate sigma factor that controls expression of late competence genes encoding DNA uptake and recombination machinery.
Genomic Context
Location: 2179273..2189425
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL23_RS10720 (NCTC7865_02161) | pth | 2180055..2180624 (-) | 570 | WP_060553299.1 | aminoacyl-tRNA hydrolase | - |
| DQL23_RS10725 (NCTC7865_02162) | ychF | 2180698..2181813 (-) | 1116 | WP_008808030.1 | redox-regulated ATPase YchF | - |
| DQL23_RS10730 (NCTC7865_02162) | - | 2181923..2181996 (-) | 74 | WP_008808030.1 | tRNA-Asn | - |
| DQL23_RS10735 (NCTC7865_02162) | - | 2182002..2182073 (-) | 72 | WP_008808030.1 | tRNA-Glu | - |
| DQL23_RS10740 (NCTC7865_02165) | comE/comE2 | 2182135..2182902 (-) | 768 | WP_008808031.1 | competence system response regulator transcription factor ComE | Regulator |
| DQL23_RS10745 (NCTC7865_02166) | comD/comD2 | 2182899..2184257 (-) | 1359 | WP_060553298.1 | competence system sensor histidine kinase ComD | Regulator |
| DQL23_RS10750 (NCTC7865_02167) | comC/comC2 | 2184273..2184425 (-) | 153 | WP_008808033.1 | bacteriocin | Regulator |
| DQL23_RS10755 (NCTC7865_02167) | - | 2184596..2184669 (-) | 74 | WP_008808033.1 | tRNA-Arg | - |
| DQL23_RS10760 (NCTC7865_02169) | rlmH | 2184712..2185191 (-) | 480 | WP_060553297.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| DQL23_RS10765 (NCTC7865_02170) | htrA | 2185385..2186578 (+) | 1194 | WP_060553296.1 | S1C family serine protease | Regulator |
| DQL23_RS10770 (NCTC7865_02171) | spo0J | 2186644..2187408 (+) | 765 | WP_045772585.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comC/comC2 | comD/comD2 | positive effect |
| comD/comD2 | comE/comE2 | positive effect |
| comE/comE2 | comC/comC2 | positive effect |
| comE/comE2 | comD/comD2 | positive effect |
Sequence
Protein
Download Length: 50 a.a. Molecular weight: 6133.22 Da Isoelectric Point: 11.2092
MKKKNKQNLLPKELQQFEILTERKLEQVTGGDIRHRINNSIWRDIFLKRK
Nucleotide
Download Length: 153 bp
ATGAAAAAGAAAAACAAACAAAATCTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGAAAGAAAATTAGAGCA
AGTTACTGGTGGAGATATTCGACATAGGATTAATAATTCAATTTGGAGAGATATTTTTTTAAAAAGAAAATAA
CSP
This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
74 |
100 |
0.74 |
Multiple sequence alignment
References
| [1] | M M Vickerman et al. (2007) Genome-wide transcriptional changes in Streptococcus gordonii in response to competence signaling peptide. Journal of Bacteriology 189(21):7799-807. [PMID: 17720781] |
| [2] | L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047] |