Detailed information    

experimental Experimentally validated

Overview

Name   comC/comC2   Type   Regulator
Locus tag   DQL23_RS10750 Genome accession   NZ_LS483341
Coordinates   2184273..2184425 (-) Length   50 a.a.
NCBI ID   WP_008808033.1    Uniprot ID   P72443
Organism   Streptococcus gordonii strain NCTC7865     
Function   binding to ComD; induce autophosphorylation of ComD   
Competence regulation

Function

In S. gordonii, pre-CSP is a 50 aa polypeptide that is cleaved at a double glycine to generate the mature 19 aa residue CSP. This peptide is then exported out of the cell via an ABC-binding cassette transporter encoded by comA and comB. Once a critical concentration of environmental CSP is reached, it is detected by the two-component system ComDE, comprising a membrane-bound histidine kinase (ComD), which phosphorylates the intracellular response regulator ComE. ComE activates a signalling cascade that includes upregulation of the master regulator SigX (designated ComR in S. gordonii), an alternate sigma factor that controls expression of late competence genes encoding DNA uptake and recombination machinery.


Genomic Context

Location: 2179273..2189425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL23_RS10720 (NCTC7865_02161) pth 2180055..2180624 (-) 570 WP_060553299.1 aminoacyl-tRNA hydrolase -
  DQL23_RS10725 (NCTC7865_02162) ychF 2180698..2181813 (-) 1116 WP_008808030.1 redox-regulated ATPase YchF -
  DQL23_RS10730 (NCTC7865_02162) - 2181923..2181996 (-) 74 WP_008808030.1 tRNA-Asn -
  DQL23_RS10735 (NCTC7865_02162) - 2182002..2182073 (-) 72 WP_008808030.1 tRNA-Glu -
  DQL23_RS10740 (NCTC7865_02165) comE/comE2 2182135..2182902 (-) 768 WP_008808031.1 competence system response regulator transcription factor ComE Regulator
  DQL23_RS10745 (NCTC7865_02166) comD/comD2 2182899..2184257 (-) 1359 WP_060553298.1 competence system sensor histidine kinase ComD Regulator
  DQL23_RS10750 (NCTC7865_02167) comC/comC2 2184273..2184425 (-) 153 WP_008808033.1 bacteriocin Regulator
  DQL23_RS10755 (NCTC7865_02167) - 2184596..2184669 (-) 74 WP_008808033.1 tRNA-Arg -
  DQL23_RS10760 (NCTC7865_02169) rlmH 2184712..2185191 (-) 480 WP_060553297.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  DQL23_RS10765 (NCTC7865_02170) htrA 2185385..2186578 (+) 1194 WP_060553296.1 S1C family serine protease Regulator
  DQL23_RS10770 (NCTC7865_02171) spo0J 2186644..2187408 (+) 765 WP_045772585.1 ParB/RepB/Spo0J family partition protein Regulator

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comC/comC2 comD/comD2 positive effect
  comD/comD2 comE/comE2 positive effect
  comE/comE2 comC/comC2 positive effect
  comE/comE2 comD/comD2 positive effect

Sequence

Protein


Download         Length: 50 a.a.        Molecular weight: 6133.22 Da        Isoelectric Point: 11.2092

>NTDB_id=418 DQL23_RS10750 WP_008808033.1 2184273..2184425(-) (comC/comC2) [Streptococcus gordonii strain NCTC7865]
MKKKNKQNLLPKELQQFEILTERKLEQVTGGDIRHRINNSIWRDIFLKRK

Nucleotide


Download         Length: 153 bp        

>NTDB_id=418 DQL23_RS10750 WP_008808033.1 2184273..2184425(-) (comC/comC2) [Streptococcus gordonii strain NCTC7865]
ATGAAAAAGAAAAACAAACAAAATCTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGAAAGAAAATTAGAGCA
AGTTACTGGTGGAGATATTCGACATAGGATTAATAATTCAATTTGGAGAGATATTTTTTTAAAAAGAAAATAA

CSP

This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:

DIRHRINNSIWRDIFLKRK


Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P72443

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus gordonii str. Challis substr. CH1

74

100

0.74

Multiple sequence alignment    



References

[1] M M Vickerman et al. (2007) Genome-wide transcriptional changes in Streptococcus gordonii in response to competence signaling peptide. Journal of Bacteriology 189(21):7799-807. [PMID: 17720781]
[2] L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047]