Detailed information NTG0000320

Experimentally validated

Overview

• Name: comX
• Type: Regulator
• Locus tag: STU_RS10340
• Genome accession: NC_006448
• Coordinates: 147638..148135 (+)
• Length: 165 a.a.
• NCBI ID: WP_002949220.1
• Uniprot ID: Q5M6C4
• Organism: Streptococcus thermophilus LMG 18311
• Function: activation of late competence genes Competence regulation

Function

ComX controls expression of the late competence genes, which are essential for DNA binding, uptake and recombination.

Genomic Context

Location: 142638..153135

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
STU_RS10320	-	143723..143944 (+)	222	WP_002948904.1	DUF4649 family protein	-
STU_RS19830	-	144029..144351 (-)	323	Protein_110	transposase	-
STU_RS10325 (stu0127)	-	144540..144866 (+)	327	WP_014607875.1	M20/M25/M40 family metallo-hydrolase	-
STU_RS10330 (stu0128)	-	144969..146159 (+)	1191	WP_041828102.1	SAM-dependent methyltransferase	-
STU_RS10335 (stu0129)	-	146420..146884 (-)	465	Protein_113	transposase family protein	-
STU_RS19045	-	147242..147346 (+)	105	Protein_114	IS200/IS605 family transposase	-
STU_RS10340 (stu0130)	comX	147638..148135 (+)	498	WP_002949220.1	sigma factor	Regulator
STU_RS10345 (stu0131)	-	148235..149077 (-)	843	WP_011225338.1	mechanosensitive ion channel family protein	-
STU_RS10350 (stu0132)	tig	149218..150501 (+)	1284	WP_011225339.1	trigger factor	-
STU_RS10355 (stu0133)	rpoE	150659..151240 (+)	582	WP_011225340.1	DNA-directed RNA polymerase subunit delta	-
STU_RS10360 (stu0134)	-	151491..153095 (+)	1605	WP_002949230.1	CTP synthase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comX	ssbA	positive effect
comX	comGE	positive effect
comX	comGB	positive effect
comX	comGD	positive effect
comX	comGF	positive effect
comX	comGG	positive effect
comX	radA	positive effect
comX	comEC	positive effect
comX	comFC	positive effect
comX		positive effect
comX	comEA	positive effect
comX	comGC	positive effect
comX	cinA	positive effect
comX	coiA	positive effect
comX	comGA	positive effect
comX	comFA	positive effect
comX	dprA	positive effect
clpC	comX	negative effect
comR	comX	positive effect
comS	comX	positive effect
clpP	comX	negative effect
mecA	comX	negative effect
comR	comS	positive effect
comS	comS	positive effect
amiC	comS	positive effect
eeP	comS	positive effect
amiD	comS	positive effect
amiF	comS	positive effect
amiA3	comS	positive effect
amiE	comS	positive effect

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20160.12 Da
• Isoelectric Point: 5.2073

>NTDB_id=320 STU_RS10340 WP_002949220.1 147638..148135(+) (comX) [Streptococcus thermophilus LMG 18311]
MEQEVFVKAYEKVRPIVLKAFRQYFIQLWDQADMEQEAMMTLYQLLKKFPDLEKDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYVEISDIAFCIPNKELDMVDRLAYDEQLNAFREQLSSEDSLKLDRLLGGECFRGRKKMIRELRFWMVDFDP
CNEED

Nucleotide

• Length: 498 bp

>NTDB_id=320 STU_RS10340 WP_002949220.1 147638..148135(+) (comX) [Streptococcus thermophilus LMG 18311]
ATGGAACAAGAAGTTTTTGTTAAGGCATATGAAAAGGTAAGGCCAATTGTACTTAAGGCTTTTAGGCAATACTTTATTCA
GCTTTGGGATCAAGCTGACATGGAGCAAGAGGCGATGATGACTTTGTATCAGCTTTTAAAAAAGTTTCCTGATTTAGAGA
AAGATGATGATAAGTTACGTCGTTACTTTAAAACTAAGTTTAGGAATCGACTTAATGATGAAGTGAGGCGGCAGGAGTCA
GTAAAACGTCAAGCTAATAGACAGTGCTATGTTGAAATTTCAGATATTGCCTTTTGTATTCCCAATAAGGAGCTAGATAT
GGTTGATAGACTTGCTTATGATGAACAGCTTAATGCATTTCGTGAGCAGTTATCATCGGAAGATTCTCTTAAGTTGGATC
GATTGTTGGGTGGTGAATGCTTTAGGGGAAGGAAAAAGATGATACGAGAGTTAAGATTTTGGATGGTTGACTTCGATCCA
TGTAATGAAGAAGACTGA

Domains

Predicted by InterProScan.

• Sigma-70 region 2 (Sigma70_r2) (10-79)

3D structure

• AlphaFold DB: Q5M6C4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus thermophilus LMD-9	100	100	1
comX/sigX	Streptococcus salivarius strain HSISS4	89.091	100	0.891
comX	Streptococcus salivarius SK126	88.485	100	0.885
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	42.581	96.875	0.413
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	42.581	96.875	0.413
comX	Streptococcus sobrinus strain NIDR 6715-7	41.975	98.182	0.412
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.667	98.734	0.411
comX/sigX	Streptococcus mutans UA159	41.026	97.5	0.4
comX/sigX	Streptococcus suis P1/7	40.523	98.077	0.397
comX/sigX	Streptococcus suis D9	40.523	98.077	0.397
comX/sigX	Streptococcus suis isolate S10	40.523	98.077	0.397
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/comX1	Streptococcus pneumoniae TIGR4	38.926	93.711	0.365
comX/comX2	Streptococcus pneumoniae TIGR4	38.926	93.711	0.365
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	37.419	97.484	0.365
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	37.419	97.484	0.365

References

• [1]: Laetitia Fontaine et al. (2013) Mechanism of competence activation by the ComRS signalling system in streptococci. Molecular Microbiology 87(6):1113-32. [PMID: 23323845]
• [2]: Laetitia Fontaine et al. (2010) A novel pheromone quorum-sensing system controls the development of natural competence in Streptococcus thermophilus and Streptococcus salivarius. Journal of Bacteriology 192(5):1444-54. [PMID: 20023010]
• [3]: Trinelise Blomqvist et al. (2006) Natural genetic transformation: A novel tool for efficient genetic engineering of the dairy bacterium Streptococcus thermophilus. Applied And Environmental Microbiology 72(10):6751-6. [PMID: 17021227]