Detailed information NTG0000468

Experimentally validated

Overview

• Name: comX/sigX
• Type: Regulator
• Locus tag: HSISS4_RS00725
• Genome accession: NZ_CP013216
• Coordinates: 127262..127759 (+)
• Length: 165 a.a.
• NCBI ID: WP_021143466.1
• Uniprot ID: A0AB33ZG65
• Organism: Streptococcus salivarius strain HSISS4
• Function: activate transcription of late competence genes Competence regulation

Function

The ComR·XIP complex will trigger the transcription of comX

Genomic Context

Location: 122262..132759

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HSISS4_RS00725 (HSISS4_00102)	comX/sigX	127262..127759 (+)	498	WP_021143466.1	sigma factor	Regulator
HSISS4_RS00730 (HSISS4_00103)	-	127867..128709 (-)	843	WP_037620105.1	mechanosensitive ion channel family protein	-
HSISS4_RS00735 (HSISS4_00105)	tig	128852..130135 (+)	1284	WP_002885606.1	trigger factor	-
HSISS4_RS00740 (HSISS4_00106)	rpoE	130293..130868 (+)	576	WP_021143468.1	DNA-directed RNA polymerase subunit delta	-
HSISS4_RS00745 (HSISS4_00107)	-	131121..132725 (+)	1605	WP_021143469.1	CTP synthase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comX/sigX	late competence genes	positive effect
comX/sigX	late competence genes	positive effect
stkP/pknB	comX/sigX	positive effect
comR	comX/sigX	positive effect
comS	comX/sigX	positive effect
covS	comR	negative effect
covR	comR	negative effect
pptA	comS	positive effect
amiD	comS	positive effect
pptB	comS	positive effect
amiE	comS	positive effect
amiC	comS	positive effect
amiF	comS	positive effect
pepF	comS	negative effect
amiA	comS	positive effect

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20023.81 Da
• Isoelectric Point: 4.9953

>NTDB_id=468 HSISS4_RS00725 WP_021143466.1 127262..127759(+) (comX/sigX) [Streptococcus salivarius strain HSISS4]
MEQEVFVHAYEVVRPIVLKASRQYFIQLWDQADMEQEAMMTLYQLLEKFPELKSDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYIEISDIAFCLPNKELDAVDRLVYDEQLNAFRNQLSSEDATKLDRLLAGECFRGRKKMIRELKFWMVDFDP
YNEDD

Nucleotide

• Length: 498 bp

>NTDB_id=468 HSISS4_RS00725 WP_021143466.1 127262..127759(+) (comX/sigX) [Streptococcus salivarius strain HSISS4]
ATGGAACAAGAAGTTTTTGTTCACGCATATGAGGTTGTTAGGCCGATTGTACTTAAGGCTAGTCGACAATATTTCATCCA
ACTTTGGGACCAAGCTGATATGGAGCAAGAAGCTATGATGACGCTTTATCAGCTTTTAGAAAAGTTTCCTGAATTAAAGT
CTGATGATGATAAGTTACGGCGTTATTTTAAAACGAAATTTAGGAATAGACTTAATGATGAGGTTAGAAGGCAGGAGTCT
GTAAAACGACAAGCCAATAGACAATGTTATATTGAAATTTCAGATATTGCTTTTTGTCTTCCGAATAAAGAGTTAGATGC
TGTTGATAGGCTTGTTTATGATGAGCAGCTTAATGCTTTCCGTAATCAGTTGTCTTCGGAAGATGCTACTAAGTTAGACC
GTTTGCTAGCTGGGGAGTGTTTTAGAGGTCGAAAAAAGATGATTCGAGAGTTAAAATTTTGGATGGTTGATTTTGATCCT
TACAATGAAGATGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus salivarius SK126	99.394	100	0.994
comX	Streptococcus thermophilus LMD-9	89.091	100	0.891
comX	Streptococcus thermophilus LMG 18311	89.091	100	0.891
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	43.226	96.875	0.419
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	43.226	96.875	0.419
comX/sigX	Streptococcus mutans UA159	41.667	97.5	0.406
comX	Streptococcus sobrinus strain NIDR 6715-7	40.606	100	0.406
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.026	98.734	0.405
comX/sigX	Streptococcus suis P1/7	39.869	98.077	0.391
comX/sigX	Streptococcus suis isolate S10	39.869	98.077	0.391
comX/sigX	Streptococcus suis D9	39.869	98.077	0.391
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382

References

• [1]: Adrien Knoops et al. (2022) A Genome-Wide CRISPR Interference Screen Reveals an StkP-Mediated Connection between Cell Wall Integrity and Competence in Streptococcus salivarius. MSystems 7(6):e0073522. [PMID: 36342134]
• [2]: Johann Mignolet et al. (2018) Circuitry Rewiring Directly Couples Competence to Predation in the Gut Dweller Streptococcus salivarius. Cell Reports 22(7):1627-1638. [PMID: 29444418]