Detailed information NTG0000554

Experimentally validated

Overview

• Name: comX/sigX
• Type: Regulator
• Locus tag: STRINF_RS00370
• Genome accession: NZ_DS572679
• Coordinates: 35341..35817 (-)
• Length: 158 a.a.
• NCBI ID: WP_115283725.1
• Uniprot ID: -
• Organism: Streptococcus infantarius subsp. infantarius ATCC BAA-102
• Function: activate transcription of late competence genes Competence regulation

Function

The results presented here begin to fill this gap, revealing a transient state of competence regulated by SigX and a type II ComR ComS pheromone circuit in S. infantarius.

Genomic Context

Location: 30341..40817

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
STRINF_RS00345 (STRINF_00075)	-	31252..31842 (-)	591	WP_006531010.1	glycoside hydrolase family 73 protein	-
STRINF_RS00350 (STRINF_00076)	-	31839..32615 (-)	777	WP_006531011.1	M15 family metallopeptidase	-
STRINF_RS00355 (STRINF_00077)	-	32599..33303 (-)	705	WP_006531012.1	histidine phosphatase family protein	-
STRINF_RS00360 (STRINF_00078)	-	33533..34870 (-)	1338	WP_006531013.1	PFL family protein	-
STRINF_RS00365 (STRINF_00079)	-	34882..35148 (-)	267	WP_006531014.1	ACT domain-containing protein	-
STRINF_RS00370 (STRINF_00080)	comX/sigX	35341..35817 (-)	477	WP_115283725.1	sigma-70 family RNA polymerase sigma factor	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comX/sigX	late competence genes	positive effect
comX/sigX	late competence genes	positive effect

Sequence

Protein

• Length: 158 a.a.
• Molecular weight: 19486.39 Da
• Isoelectric Point: 8.2477

>NTDB_id=554 STRINF_RS00370 WP_115283725.1 35341..35817(-) (comX/sigX) [Streptococcus infantarius subsp. infantarius ATCC BAA-102]
MDFERYFQTVKPIILKLRRHYFVKLWDYEDWIQEGRIVFFQLLEEHPDLLNNEGKCYSYFKTKFSNHVKDIIRHQESFKR
KFNRMPYEEISDISHCVPQVFFFEVEDYVAYQDSLACLRRTLGREDRLKLEKVIRGERFEGKKAFLKSIELYFSDFRP

Nucleotide

• Length: 477 bp

>NTDB_id=554 STRINF_RS00370 WP_115283725.1 35341..35817(-) (comX/sigX) [Streptococcus infantarius subsp. infantarius ATCC BAA-102]
GTGGATTTTGAACGCTATTTTCAAACGGTTAAACCAATTATTTTAAAATTACGCCGTCATTATTTTGTCAAACTTTGGGA
TTATGAAGATTGGATTCAAGAAGGTCGAATTGTTTTCTTTCAACTCTTAGAGGAGCATCCAGACCTCTTAAATAATGAAG
GCAAATGCTATAGCTACTTTAAAACAAAATTTTCTAACCATGTTAAAGATATTATCCGCCATCAGGAATCCTTTAAACGG
AAATTTAATCGCATGCCTTATGAAGAAATTAGTGATATTAGTCACTGTGTGCCCCAGGTATTTTTCTTTGAAGTCGAAGA
TTACGTGGCTTATCAGGATAGCTTAGCTTGTTTACGAAGAACATTGGGAAGAGAAGACCGACTAAAGTTGGAAAAAGTGA
TTCGTGGGGAACGTTTTGAAGGGAAGAAAGCCTTTTTAAAAAGCATTGAACTGTATTTCTCAGATTTTAGACCATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	49.333	94.937	0.468
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	49.333	94.937	0.468
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	49.333	94.937	0.468
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	49.333	94.937	0.468
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	49.333	94.937	0.468
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	49.333	94.937	0.468
comX/sigX	Streptococcus mutans UA159	45.513	98.734	0.449
comX	Streptococcus sobrinus strain NIDR 6715-7	46.104	97.468	0.449
comX	Streptococcus thermophilus LMD-9	41.667	98.734	0.411
comX	Streptococcus thermophilus LMG 18311	41.667	98.734	0.411
comX/sigX	Streptococcus salivarius strain HSISS4	41.026	98.734	0.405
comX	Streptococcus salivarius SK126	41.026	98.734	0.405
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	39.873	100	0.399
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	39.873	100	0.399
comX/sigX	Streptococcus suis isolate S10	38.854	100	0.391
comX/sigX	Streptococcus suis D9	38.854	100	0.391
comX/sigX	Streptococcus suis P1/7	38.854	100	0.391

References

• [1]: Donald A Morrison et al. (2013) Competence for natural genetic transformation in the Streptococcus bovis group streptococci S. infantarius and S. macedonicus. Journal of Bacteriology 195(11):2612-20. [PMID: 23543718]