Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | STU_RS18120 | Genome accession | NC_006448 |
| Coordinates | 1655875..1656192 (-) | Length | 105 a.a. |
| NCBI ID | WP_011226623.1 | Uniprot ID | Q5M2G4 |
| Organism | Streptococcus thermophilus LMG 18311 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1650875..1661192
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STU_RS18090 (stu1853) | - | 1651224..1651886 (-) | 663 | WP_011226617.1 | CPBP family intramembrane glutamic endopeptidase | - |
| STU_RS18095 (stu1854) | - | 1651989..1652437 (-) | 449 | Protein_1626 | CAAX protease | - |
| STU_RS20820 (stu1855) | - | 1652511..1652936 (-) | 426 | WP_041827107.1 | CPBP family intramembrane glutamic endopeptidase | - |
| STU_RS18105 (stu1856) | - | 1653179..1653376 (-) | 198 | WP_011681682.1 | helix-turn-helix transcriptional regulator | - |
| STU_RS18110 (stu1857) | - | 1653625..1654818 (-) | 1194 | WP_022096898.1 | acetate kinase | - |
| STU_RS18115 (stu1858) | comGH | 1654874..1655830 (-) | 957 | WP_011226622.1 | class I SAM-dependent methyltransferase | Machinery gene |
| STU_RS18120 (stu1859) | comGG | 1655875..1656192 (-) | 318 | WP_011226623.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| STU_RS18125 (stu1860) | comGF | 1656170..1656607 (-) | 438 | WP_014608742.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| STU_RS18130 (stu1861) | comGE | 1656591..1656884 (-) | 294 | WP_011226625.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| STU_RS18135 (stu1862) | comGD | 1656856..1657284 (-) | 429 | WP_011226626.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| STU_RS18140 (stu1863) | comGC | 1657244..1657570 (-) | 327 | WP_011226627.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| STU_RS18145 (stu1864) | comGB | 1657567..1658667 (-) | 1101 | WP_148148900.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| STU_RS18150 (stu1865) | comGA | 1658549..1659490 (-) | 942 | WP_011226629.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| STU_RS18155 (stu1866) | - | 1659571..1659933 (-) | 363 | WP_011226630.1 | DUF1033 family protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comX | comGG | positive effect |
| comX | ssbA | positive effect |
| comX | comGE | positive effect |
| comX | comGB | positive effect |
| comX | comGD | positive effect |
| comX | comGF | positive effect |
| comX | radA | positive effect |
| comX | comEC | positive effect |
| comX | comFC | positive effect |
| comX | positive effect |
|
| comX | comEA | positive effect |
| comX | comGC | positive effect |
| comX | cinA | positive effect |
| comX | coiA | positive effect |
| comX | comGA | positive effect |
| comX | comFA | positive effect |
| comX | dprA | positive effect |
| clpC | comX | negative effect |
| comR | comX | positive effect |
| comR | comS | positive effect |
| comS | comX | positive effect |
| comS | comS | positive effect |
| amiC | comS | positive effect |
| eeP | comS | positive effect |
| amiD | comS | positive effect |
| amiF | comS | positive effect |
| amiA3 | comS | positive effect |
| amiE | comS | positive effect |
| clpP | comX | negative effect |
| mecA | comX | negative effect |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11796.88 Da Isoelectric Point: 10.6334
>NTDB_id=342 STU_RS18120 WP_011226623.1 1655875..1656192(-) (comGG) [Streptococcus thermophilus LMG 18311]
MLLKKQVRGGVLLYALFMAGIFTLLLQAYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK
MLLKKQVRGGVLLYALFMAGIFTLLLQAYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK
Nucleotide
Download Length: 318 bp
>NTDB_id=342 STU_RS18120 WP_011226623.1 1655875..1656192(-) (comGG) [Streptococcus thermophilus LMG 18311]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGCTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGCTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Streptococcus mutans UA140 |
45.455 |
94.286 |
0.429 |
| comGG | Streptococcus mutans UA159 |
45.455 |
94.286 |
0.429 |
| comGG/cglG | Streptococcus pneumoniae Rx1 |
42.222 |
85.714 |
0.362 |
| comGG/cglG | Streptococcus pneumoniae D39 |
42.222 |
85.714 |
0.362 |
| comGG/cglG | Streptococcus pneumoniae R6 |
42.222 |
85.714 |
0.362 |
| comGG/cglG | Streptococcus pneumoniae TIGR4 |
42.222 |
85.714 |
0.362 |