Detailed information NTG0000400

Experimentally validated

Overview

• Name: comYG
• Type: Machinery gene
• Locus tag: FSA28_RS09375
• Genome accession: NZ_CP044495
• Coordinates: 1858274..1858663 (-)
• Length: 129 a.a.
• NCBI ID: WP_002263441.1
• Uniprot ID: -
• Organism: Streptococcus mutans UA140
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake

Function

RT-PCR analysis of the orf junctions confirmed that all nine orfs of comY operon were present in a single transcript, while real-time RT-PCR analysis demonstrated that these orfs were expressed at a level very similar to that of the first orf in the operon. Mutations were constructed in all nine putative orfs. The first seven genes (comYA-G) were found to be essential for natural competence, while comYH and comYI had reduced and normal natural competence ability, respectively.

Genomic Context

Location: 1853274..1863663

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FSA28_RS09345 (FSA28_1632)	-	1854114..1854497 (-)	384	WP_088741902.1	hypothetical protein	-
FSA28_RS09350 (FSA28_1633)	-	1854466..1854711 (-)	246	WP_002265894.1	helix-turn-helix transcriptional regulator	-
FSA28_RS09360 (FSA28_1634)	tnpA	1855331..1855794 (-)	464	Protein_1743	IS200/IS605 family transposase	-
FSA28_RS09365 (FSA28_1635)	comYI	1856008..1857207 (-)	1200	WP_002263443.1	acetate kinase	Machinery gene
FSA28_RS09370 (FSA28_1636)	comYH	1857266..1858219 (-)	954	WP_002291646.1	class I SAM-dependent methyltransferase	Machinery gene
FSA28_RS09375 (FSA28_1637)	comYG	1858274..1858663 (-)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
FSA28_RS09380 (FSA28_1638)	comYF	1858641..1859075 (-)	435	WP_002264245.1	competence type IV pilus minor pilin ComGF	Machinery gene
FSA28_RS09385 (FSA28_1639)	comYE	1859062..1859355 (-)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
FSA28_RS09390 (FSA28_1640)	comYD	1859327..1859731 (-)	405	WP_002263438.1	competence type IV pilus minor pilin ComGD	Machinery gene
FSA28_RS09395 (FSA28_1641)	comYC	1859718..1860032 (-)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
FSA28_RS09400 (FSA28_1642)	comYB	1860032..1861063 (-)	1032	WP_257638827.1	competence type IV pilus assembly protein ComGB	Machinery gene
FSA28_RS09405 (FSA28_1643)	comYA	1860999..1861940 (-)	942	WP_002291652.1	competence type IV pilus ATPase ComGA	Machinery gene
FSA28_RS09410 (FSA28_1644)	-	1862071..1862454 (-)	384	WP_002263434.1	DUF1033 family protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14954.27 Da
• Isoelectric Point: 10.2940

>NTDB_id=400 FSA28_RS09375 WP_002263441.1 1858274..1858663(-) (comYG) [Streptococcus mutans UA140]
MLFMKKIKAGVLLYALFMSAIFSLFLQFYLNRVVATERQNQAQLSASKAYLIADLTQDLAKDNFGQLTFNHGRSSYHKQE
GELLIKVHLTDGQSYQYRFNCVTENKEKGKFSVANKTFTKSIEKRHFQK

Nucleotide

• Length: 390 bp

>NTDB_id=400 FSA28_RS09375 WP_002263441.1 1858274..1858663(-) (comYG) [Streptococcus mutans UA140]
ATGCTTTTCATGAAAAAAATTAAAGCAGGCGTACTTCTATATGCTCTGTTTATGTCAGCAATCTTTAGTCTTTTCTTACA
ATTTTATCTTAATCGTGTTGTAGCAACAGAGAGACAAAATCAGGCACAATTATCGGCCAGTAAAGCTTATCTTATAGCAG
ATCTAACTCAAGATTTGGCTAAAGACAACTTTGGGCAGTTGACTTTTAATCACGGAAGGTCTAGTTATCATAAACAGGAG
GGGGAACTTCTGATAAAAGTCCATTTGACAGATGGTCAGTCCTACCAATATCGTTTTAACTGTGTAACAGAAAATAAGGA
AAAAGGAAAATTTAGTGTGGCTAATAAAACTTTTACTAAATCTATAGAAAAACGTCATTTTCAAAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYG	Streptococcus mutans UA159	100	100	1
comGG/cglG	Streptococcus pneumoniae R6	38.806	97.81	0.38
comGG/cglG	Streptococcus pneumoniae D39	38.806	97.81	0.38
comGG/cglG	Streptococcus pneumoniae Rx1	38.806	97.81	0.38
comGG/cglG	Streptococcus pneumoniae TIGR4	38.806	97.81	0.38

References

• [1]: Justin Merritt et al. (2005) A unique nine-gene comY operon in Streptococcus mutans. Microbiology (Reading, England) 151(Pt 1):157-166. [PMID: 15632435]