Detailed information NTG0001108

Experimentally validated

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: NGFG_RS06525
• Genome accession: NC_022240
• Coordinates: 1184452..1184847 (-)
• Length: 131 a.a.
• NCBI ID: WP_003703428.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae MS11
• Function: DNA binding DNA binding and uptake

Function

Single-copy deletion of comE in N. gonorrhoeae did not have a measurable effect on competence, whereas serial deletions led to gradual decrease in transformation frequencies, reaching a 4 x 10(4)-fold reduction when all copies were deleted. Recombinant His-tagged ComE showed DNA binding activity, without any detectable sequence specificity.

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1180402..1191652	1184452..1184847	within	0

Gene organization within MGE regions

Location: 1180402..1191652

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NGFG_RS16035	-	1180402..1180998 (-)	597	WP_012503916.1	TIGR02391 family protein	-
NGFG_RS16040	-	1181188..1182045 (-)	858	WP_012503917.1	ATP-binding protein	-
NGFG_RS06505	-	1182059..1182430 (-)	372	WP_012503918.1	DNA cytosine methyltransferase	-
NGFG_RS06510	-	1182427..1183017 (-)	591	WP_080229150.1	DNA cytosine methyltransferase	-
NGFG_RS06515 (NGFG_02183)	-	1183392..1183538 (+)	147	WP_003691757.1	hypothetical protein	-
NGFG_RS06520 (NGFG_02184)	comP	1183915..1184364 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
NGFG_RS06525 (NGFG_02391)	comE	1184452..1184847 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
NGFG_RS16045	-	1184962..1185067 (-)	106	Protein_1237	competence protein ComE	-
NGFG_RS14520 (NGFG_01985)	-	1190701..1191354 (-)	654	Protein_1238	TIGR01621 family pseudouridine synthase	-
NGFG_RS14525 (NGFG_01986)	-	1191308..1191652 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 13796.61 Da
• Isoelectric Point: 10.8790

>NTDB_id=1108 NGFG_RS06525 WP_003703428.1 1184452..1184847(-) (comE) [Neisseria gonorrhoeae MS11]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide

• Length: 396 bp

>NTDB_id=1108 NGFG_RS06525 WP_003703428.1 1184452..1184847(-) (comE) [Neisseria gonorrhoeae MS11]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (52-110)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	51.852	100	0.532
comEA	Vibrio campbellii strain DS40M4	40.86	97.895	0.4
comEA	Vibrio parahaemolyticus RIMD 2210633	38.889	95.745	0.372

References

• [1]: I Chen et al. (2001) ComE, a competence protein from Neisseria gonorrhoeae with DNA-binding activity. Journal of Bacteriology 183(10):3160-8. [PMID: 11325945]