Detailed information NTG0001395

Experimentally validated

Overview

• Name: comEA
• Type: Machinery gene
• Locus tag: DSB67_RS04445
• Genome accession: NZ_CP030788
• Coordinates: 925709..925996 (+)
• Length: 95 a.a.
• NCBI ID: WP_010649155.1
• Uniprot ID: A0AAE9MUX7
• Organism: Vibrio campbellii strain DS40M4
• Function: dsDNA binding DNA binding and uptake

Function

Induction of TfoX expression resulted in upregulation of the genes required for DNA uptake and integration (comEC, comEA, comM, comF, and dprA) and pilus structure (pilABCD, pilMNOPQ, and minor pilins VC0857 to -0861) in DS40M4

Genomic Context

Location: 920709..930996

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DSB67_RS04435 (DSB67_04435)	-	923217..923489 (+)	273	WP_005430934.1	HU family DNA-binding protein	-
DSB67_RS04440 (DSB67_04440)	ppiD	923704..925563 (+)	1860	WP_010649168.1	peptidylprolyl isomerase	-
DSB67_RS04445 (DSB67_04445)	comEA	925709..925996 (+)	288	WP_010649155.1	ComEA family DNA-binding protein	Machinery gene
DSB67_RS04450 (DSB67_04450)	rrtA	926142..926693 (-)	552	WP_010649153.1	rhombosortase	-
DSB67_RS04455 (DSB67_04455)	-	926697..927314 (+)	618	WP_010649151.1	tRNA-uridine aminocarboxypropyltransferase	-
DSB67_RS04460 (DSB67_04460)	-	927334..928668 (-)	1335	WP_033002287.1	anti-phage deoxyguanosine triphosphatase	-
DSB67_RS04465 (DSB67_04465)	yfbR	928672..929256 (-)	585	WP_010649149.1	5'-deoxynucleotidase	-
DSB67_RS04470 (DSB67_04470)	-	929340..930554 (-)	1215	WP_010649148.1	pyridoxal phosphate-dependent aminotransferase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
tfoX	comEA	positive effect
tfoX	pilB	positive effect
tfoX	dprA	positive effect
tfoX	pilC	positive effect
tfoX	pilD	positive effect
tfoX	pilM	positive effect
tfoX	pilO	positive effect
tfoX	comM	positive effect
tfoX	pilA	positive effect
tfoX	pilQ	positive effect
tfoX	comEC	positive effect
tfoX	pilP	positive effect
tfoX	comF	positive effect
tfoX	pilN	positive effect

Sequence

Protein

• Length: 95 a.a.
• Molecular weight: 10560.33 Da
• Isoelectric Point: 6.9800

>NTDB_id=1395 DSB67_RS04445 WP_010649155.1 925709..925996(+) (comEA) [Vibrio campbellii strain DS40M4]
MKWMLTLCLLILAPMSWAETKTKADKYEGIEITVNVNSATAQEIATLLIGIGEKKAQDIVEYRNEHGPFKTAADLTKVKG
IGEATVRKNEDRILL

Nucleotide

• Length: 288 bp

>NTDB_id=1395 DSB67_RS04445 WP_010649155.1 925709..925996(+) (comEA) [Vibrio campbellii strain DS40M4]
ATGAAATGGATGTTAACACTGTGCTTATTGATACTCGCGCCGATGAGCTGGGCGGAAACAAAGACTAAAGCGGATAAGTA
TGAAGGTATTGAGATTACGGTTAACGTTAACTCTGCCACTGCACAAGAGATTGCGACGCTACTTATTGGTATTGGTGAGA
AGAAAGCGCAAGATATTGTTGAGTATCGCAACGAGCACGGCCCATTTAAAACCGCTGCGGATCTTACAAAGGTGAAAGGC
ATCGGTGAGGCGACTGTGAGGAAGAACGAAGACCGCATCCTGCTGTAA

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (33-93)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comEA	Vibrio parahaemolyticus RIMD 2210633	77.895	100	0.787
comEA	Vibrio cholerae strain A1552	58.333	100	0.589
comEA	Vibrio cholerae C6706	58.333	100	0.589
comE1/comEA	Haemophilus influenzae Rd KW20	39.286	100	0.463
comEA	Acinetobacter baumannii strain A118	32.787	100	0.421
comE	Neisseria gonorrhoeae MS11	40.86	97.895	0.4
comE	Neisseria gonorrhoeae MS11	40.86	97.895	0.4
comE	Neisseria gonorrhoeae MS11	40.86	97.895	0.4
comE	Neisseria gonorrhoeae MS11	40.86	97.895	0.4
comEA	Acinetobacter baylyi ADP1	48.649	77.895	0.379
comEA/comE1	Glaesserella parasuis strain SC1401	56.452	65.263	0.368
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	48.333	75.949	0.367

References

• [1]: Chelsea A Simpson et al. (2019) Diversity in Natural Transformation Frequencies and Regulation across Vibrio Species. MBio 10(6):e02788-19. [PMID: 31848285]