Detailed information NTG0000105

Experimentally validated

Overview

• Name: comEA
• Type: Machinery gene
• Locus tag: BSU_25590
• Genome accession: NC_000964
• Coordinates: 2640513..2641130 (-)
• Length: 205 a.a.
• NCBI ID: NP_390437.1
• Uniprot ID: P39694
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: dsDNA binding to the cell surface DNA binding and uptake

Function

ComEA is a non-specific DNA-binding protein required for both stable binding of double-stranded DNA to the cell surface and for its subsequent uptake into the periplasm. Additionally, recent studies have shown that ComEA contains an oligomerization domain that drives the formation of multimers, which is necessary for efficient DNA uptake and transformation. ComEA works in concert with other proteins such as ComEC, which is involved in the transport of single-stranded DNA from the periplasm to the cytoplasm.

Genomic Context

Location: 2635513..2646130

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_25550 (BSU25550)	rpsT	2635815..2636081 (+)	267	NP_390433.2	ribosomal protein S20 (BS20)	-
BSU_25560 (BSU25560)	holA	2636096..2637139 (-)	1044	NP_390434.1	DNA polymerase clamp loader delta subunit	-
BSU_25565 (BSU25565)	-	2637179..2637328 (-)	150	YP_009513978.1	hypothetical protein	-
BSU_25569 (BSU25569)	yqzM	2637369..2637503 (+)	135	YP_003097762.1	hypothetical protein	-
BSU_25570 (BSU25570)	comEC	2637543..2639873 (-)	2331	NP_390435.1	DNA channel for uptake in competent cells	Machinery gene
BSU_25580 (BSU25580)	comEB	2639877..2640446 (-)	570	NP_390436.1	dCMP deaminase associated to DNA transport (competence)	Regulator
BSU_25590 (BSU25590)	comEA	2640513..2641130 (-)	618	NP_390437.1	membrane bound high-affinity DNA-binding receptor	Machinery gene
BSU_25600 (BSU25600)	comER	2641214..2642035 (+)	822	NP_390438.1	putative pyrroline-5'-carboxylate reductase	-
BSU_25610 (BSU25610)	yqeM	2642101..2642844 (-)	744	NP_390439.1	putative methyltransferase	-
BSU_25620 (BSU25620)	rsfS	2642841..2643197 (-)	357	NP_390440.1	ribosomal silencing factor	-
BSU_25630 (BSU25630)	yqeK	2643215..2643775 (-)	561	NP_390441.1	putative hydrolase	-
BSU_25640 (BSU25640)	nadD	2643765..2644334 (-)	570	NP_390442.1	nicotinate-nucleotide adenylyltransferase	-
BSU_25650 (BSU25650)	yqeI	2644346..2644636 (-)	291	NP_390443.1	50S RNA-binding protein	-
BSU_25660 (BSU25660)	aroE	2644630..2645472 (-)	843	NP_390444.2	shikimate 5-dehydrogenase	-

Sequence

Protein

• Length: 205 a.a.
• Molecular weight: 21769.45 Da
• Isoelectric Point: 4.7220

>NTDB_id=105 BSU_25590 NP_390437.1 2640513..2641130(-) (comEA) [Bacillus subtilis subsp. subtilis str. 168]
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK

Nucleotide

• Length: 618 bp

>NTDB_id=105 BSU_25590 NP_390437.1 2640513..2641130(-) (comEA) [Bacillus subtilis subsp. subtilis str. 168]
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAGGAAAACGGTCGTTTCCAAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (142-203)

• SLBB domain (SLBB) (63-118)

3D structure

• PDB: 8DFK

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	57.377	77.215	0.443
comEA	Staphylococcus aureus MW2	37.273	100	0.4
comEA	Staphylococcus aureus N315	36.364	100	0.39
comEA/celA/cilE	Streptococcus pneumoniae R6	41.579	87.963	0.366
comEA/celA/cilE	Streptococcus pneumoniae Rx1	41.579	87.963	0.366
comEA/celA/cilE	Streptococcus pneumoniae D39	41.579	87.963	0.366

References

• [1]: Marie Burghard-Schrod et al. (2022) Single-Molecule Dynamics of DNA Receptor ComEA, Membrane Permease ComEC, and Taken-Up DNA in Competent Bacillus subtilis Cells. Journal of Bacteriology 204(3):e0057221. [PMID: 34928178]
• [2]: Ishtiyaq Ahmed et al. (2022) Structure-function studies reveal ComEA contains an oligomerization domain essential for transformation in gram-positive bacteria. Nature Communications 13(1):7724. [PMID: 36513643]
• [3]: Ralf Salzer et al. (2016) The Thermus thermophilus comEA/comEC operon is associated with DNA binding and regulation of the DNA translocator and type IV pili. Environmental Microbiology 18(1):65-74. [PMID: 25727469]
• [4]: Masaomi Takeno et al. (2012) Role of ComEA in DNA uptake during transformation of competent Bacillus subtilis. Journal of Bioscience And Bioengineering 113(6):689-93. [PMID: 22398145]
• [5]: Miriam Kaufenstein et al. (2011) The three-layered DNA uptake machinery at the cell pole in competent Bacillus subtilis cells is a stable complex. Journal of Bacteriology 193(7):1633-42. [PMID: 21278288]
• [6]: Naomi Kramer et al. (2007) Multiple interactions among the competence proteins of Bacillus subtilis. Molecular Microbiology 65(2):454-64. [PMID: 17630974]
• [7]: Inês Chen et al. (2006) A macromolecular complex formed by a pilin-like protein in competent Bacillus subtilis. The Journal of Biological Chemistry 281(31):21720-21727. [PMID: 16751195]
• [8]: R Provvedi et al. (1999) ComEA is a DNA receptor for transformation of competent Bacillus subtilis. Molecular Microbiology 31(1):271-80. [PMID: 9987128]
• [9]: G S Inamine et al. (1995) ComEA, a Bacillus subtilis integral membrane protein required for genetic transformation, is needed for both DNA binding and transport. Journal of Bacteriology 177(11):3045-51. [PMID: 7768800]