Detailed information
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | BSU_25590 | Genome accession | NC_000964 |
| Coordinates | 2640513..2641130 (-) | Length | 205 a.a. |
| NCBI ID | NP_390437.1 | Uniprot ID | P39694 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | dsDNA binding to the cell surface DNA binding and uptake |
||
Function
ComEA is a non-specific DNA-binding protein required for both stable binding of double-stranded DNA to the cell surface and for its subsequent uptake into the periplasm. Additionally, recent studies have shown that ComEA contains an oligomerization domain that drives the formation of multimers, which is necessary for efficient DNA uptake and transformation. ComEA works in concert with other proteins such as ComEC, which is involved in the transport of single-stranded DNA from the periplasm to the cytoplasm.
Genomic Context
Location: 2635513..2646130
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_25550 (BSU25550) | rpsT | 2635815..2636081 (+) | 267 | NP_390433.2 | ribosomal protein S20 (BS20) | - |
| BSU_25560 (BSU25560) | holA | 2636096..2637139 (-) | 1044 | NP_390434.1 | DNA polymerase clamp loader delta subunit | - |
| BSU_25565 (BSU25565) | - | 2637179..2637328 (-) | 150 | YP_009513978.1 | hypothetical protein | - |
| BSU_25569 (BSU25569) | yqzM | 2637369..2637503 (+) | 135 | YP_003097762.1 | hypothetical protein | - |
| BSU_25570 (BSU25570) | comEC | 2637543..2639873 (-) | 2331 | NP_390435.1 | DNA channel for uptake in competent cells | Machinery gene |
| BSU_25580 (BSU25580) | comEB | 2639877..2640446 (-) | 570 | NP_390436.1 | dCMP deaminase associated to DNA transport (competence) | Regulator |
| BSU_25590 (BSU25590) | comEA | 2640513..2641130 (-) | 618 | NP_390437.1 | membrane bound high-affinity DNA-binding receptor | Machinery gene |
| BSU_25600 (BSU25600) | comER | 2641214..2642035 (+) | 822 | NP_390438.1 | putative pyrroline-5'-carboxylate reductase | - |
| BSU_25610 (BSU25610) | yqeM | 2642101..2642844 (-) | 744 | NP_390439.1 | putative methyltransferase | - |
| BSU_25620 (BSU25620) | rsfS | 2642841..2643197 (-) | 357 | NP_390440.1 | ribosomal silencing factor | - |
| BSU_25630 (BSU25630) | yqeK | 2643215..2643775 (-) | 561 | NP_390441.1 | putative hydrolase | - |
| BSU_25640 (BSU25640) | nadD | 2643765..2644334 (-) | 570 | NP_390442.1 | nicotinate-nucleotide adenylyltransferase | - |
| BSU_25650 (BSU25650) | yqeI | 2644346..2644636 (-) | 291 | NP_390443.1 | 50S RNA-binding protein | - |
| BSU_25660 (BSU25660) | aroE | 2644630..2645472 (-) | 843 | NP_390444.2 | shikimate 5-dehydrogenase | - |
Sequence
Protein
Download Length: 205 a.a. Molecular weight: 21769.45 Da Isoelectric Point: 4.7220
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK
Nucleotide
Download Length: 618 bp
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAGGAAAACGGTCGTTTCCAAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| Cj0011c | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
57.377 |
77.215 |
0.443 |
| comEA | Staphylococcus aureus MW2 |
37.273 |
100 |
0.4 |
| comEA | Staphylococcus aureus N315 |
36.364 |
100 |
0.39 |
| comEA/celA/cilE | Streptococcus pneumoniae Rx1 |
41.579 |
87.963 |
0.366 |
| comEA/celA/cilE | Streptococcus pneumoniae D39 |
41.579 |
87.963 |
0.366 |
| comEA/celA/cilE | Streptococcus pneumoniae R6 |
41.579 |
87.963 |
0.366 |
Multiple sequence alignment
References
| [1] | Marie Burghard-Schrod et al. (2022) Single-Molecule Dynamics of DNA Receptor ComEA, Membrane Permease ComEC, and Taken-Up DNA in Competent Bacillus subtilis Cells. Journal of Bacteriology 204(3):e0057221. [PMID: 34928178] |
| [2] | Ishtiyaq Ahmed et al. (2022) Structure-function studies reveal ComEA contains an oligomerization domain essential for transformation in gram-positive bacteria. Nature Communications 13(1):7724. [PMID: 36513643] |
| [3] | Ralf Salzer et al. (2016) The Thermus thermophilus comEA/comEC operon is associated with DNA binding and regulation of the DNA translocator and type IV pili. Environmental Microbiology 18(1):65-74. [PMID: 25727469] |
| [4] | Masaomi Takeno et al. (2012) Role of ComEA in DNA uptake during transformation of competent Bacillus subtilis. Journal of Bioscience And Bioengineering 113(6):689-93. [PMID: 22398145] |
| [5] | Miriam Kaufenstein et al. (2011) The three-layered DNA uptake machinery at the cell pole in competent Bacillus subtilis cells is a stable complex. Journal of Bacteriology 193(7):1633-42. [PMID: 21278288] |
| [6] | Naomi Kramer et al. (2007) Multiple interactions among the competence proteins of Bacillus subtilis. Molecular Microbiology 65(2):454-64. [PMID: 17630974] |
| [7] | Inês Chen et al. (2006) A macromolecular complex formed by a pilin-like protein in competent Bacillus subtilis. The Journal of Biological Chemistry 281(31):21720-21727. [PMID: 16751195] |
| [8] | R Provvedi et al. (1999) ComEA is a DNA receptor for transformation of competent Bacillus subtilis. Molecular Microbiology 31(1):271-80. [PMID: 9987128] |
| [9] | G S Inamine et al. (1995) ComEA, a Bacillus subtilis integral membrane protein required for genetic transformation, is needed for both DNA binding and transport. Journal of Bacteriology 177(11):3045-51. [PMID: 7768800] |