Detailed information
Overview
| Name | comE | Type | Regulator |
| Locus tag | SPD_RS10920 | Genome accession | NC_008533 |
| Coordinates | 2040743..2041495 (-) | Length | 250 a.a. |
| NCBI ID | WP_000866065.1 | Uniprot ID | Q79CK7 |
| Organism | Streptococcus pneumoniae D39 | ||
| Function | activate transcription of early competence genes Competence regulation |
||
Function
The comE gene encodes a response regulator that is phosphorylated by the histidine kinase ComD upon binding of the competence-stimulating peptide (CSP). ComE∼P is the active form of ComE, which recognizes and binds to a specific DNA motif, or ComE-box, upstream of early com genes and comX. By stimulating further transcription of early com genes, ComE∼P creates a positive amplification loop of the signal, which maintains the competent state for DNA uptake.
Genomic Context
Location: 2035743..2046495
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPD_RS12055 (SPD_2059) | - | 2038176..2039779 (-) | 1604 | Protein_2017 | YhgE/Pip family protein | - |
| SPD_RS10905 (SPD_2060) | - | 2039958..2040500 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| SPD_RS10920 (SPD_2063) | comE | 2040743..2041495 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| SPD_RS10925 (SPD_2064) | comD/comD1 | 2041492..2042817 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| SPD_RS10930 (SPD_2065) | comC/comC1 | 2042838..2042963 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| SPD_RS10940 (SPD_2067) | rlmH | 2043245..2043724 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| SPD_RS10945 (SPD_2068) | htrA | 2043907..2045088 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| SPD_RS10950 (SPD_2069) | spo0J | 2045146..2045904 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comE | comM | positive effect |
| comM | cbpD | negative effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| comE | comW | positive effect |
| comE | comA | positive effect |
| comE | comB | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comD/comD1 | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comC/comC1 | positive effect |
| comD/comD1 | comE | positive effect |
| stkP | comE | positive effect |
| ccpA | comE | positive effect |
| comW | comX/comX1 | positive effect |
| comX/comX1 | late competence genes | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| comW | comX/comX2 | positive effect |
| comX/comX2 | late competence genes | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| comA | comC/comC1 | positive effect |
| comC/comC1 | comD/comD1 | positive effect |
| ccpA | comC/comC1 | positive effect |
| comB | comC/comC1 | positive effect |
| htrA | comC/comC1 | negative effect |
| ciaR | comC/comC1 | negative effect |
| ciaH | comC/comC1 | negative effect |
| ccpA | comD/comD1 | positive effect |
| comX/comX2 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
| htrA | comEA/celA/cilE | negative effect |
| htrA | comEC/celB | negative effect |
| ciaR | htrA | positive effect |
| ciaH | htrA | positive effect |
Sequence
Protein
Download Length: 250 a.a. Molecular weight: 29958.31 Da Isoelectric Point: 6.5073
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLDIDIHGIEKKGFEVAQLIRHYNP
YAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILY
IETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKL
KDILEKKSQK
Nucleotide
Download Length: 753 bp
ATGAAAGTTTTAATTTTAGAAGATGTTATTGAACATCAAGTGAGACTAGAGAGAATATTGGATGAAATTTCGAAAGAATC
GAATATTCCAATATCATACAAGACAACGGGAAAAGTCCGTGAATTTGAAGAATACATTGAAAATGATGAAGTAAATCAGC
TTTATTTCCTAGATATCGATATTCATGGAATTGAGAAAAAGGGATTTGAAGTGGCTCAGCTCATTCGTCATTACAATCCT
TACGCTATTATCGTCTTTATCACTAGTCGATCAGAGTTTGCGACTCTAACATATAAATACCAGGTATCAGCCCTAGATTT
TGTTGATAAGGATATCAATGATGAGATGTTTAAGAAGAGAATTGAGCAAAATATCTTCTACACGAAGAGTATGTTACTTG
AAAATGAAGATGTTGTAGATTATTTCGACTACAATTACAAGGGAAATGATTTAAAAATTCCTTACCATGATATTTTGTAT
ATTGAAACAACAGGGGTATCTCATAAATTGCGCATTATTGGTAAGAATTTTGCAAAAGAGTTTTATGGTACCATGACAGA
TATTCAGGAAAAGGACAAACATACTCAGCGATTTTATTCTCCTCACAAGTCATTTTTGGTAAATATAGGCAATATCAGAG
AAATTGATCGAAAAAACTTAGAAATTGTTTTCTATGAAGACCATCGTTGTCCTATTTCAAGATTAAAAATTAGAAAATTA
AAAGATATTTTAGAGAAAAAATCTCAAAAGTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comE | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comE | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comE | Streptococcus mitis SK321 |
99.2 |
100 |
0.992 |
| comE | Streptococcus mitis NCTC 12261 |
98.4 |
100 |
0.984 |
| comE | Streptococcus infantis strain Atu-4 |
91.2 |
100 |
0.912 |
| comE/comE2 | Streptococcus gordonii strain NCTC7865 |
62.8 |
100 |
0.628 |
| comE/comE1 | Streptococcus gordonii str. Challis substr. CH1 |
62.8 |
100 |
0.628 |
| comE/blpR | Streptococcus mutans UA159 |
41.296 |
98.8 |
0.408 |
| comE/comE2 | Streptococcus equinus JB1 |
35.039 |
100 |
0.365 |
Multiple sequence alignment
References
| [1] | Germán E Piñas et al. (2018) Crosstalk between the serine/threonine kinase StkP and the response regulator ComE controls the stress response and intracellular survival of Streptococcus pneumoniae. PLoS Pathogens 14(6):e1007118. [PMID: 29883472] |
| [2] | Yuqiang Zheng et al. (2017) ComE, an Essential Response Regulator, Negatively Regulates the Expression of the Capsular Polysaccharide Locus and Attenuates the Bacterial Virulence in Streptococcus pneumoniae. Frontiers in Microbiology 8:277. [PMID: 28326061] |
| [3] | Marion Boudes et al. (2014) Structural insights into the dimerization of the response regulator ComE from Streptococcus pneumoniae. Nucleic Acids Research 42(8):5302-13. [PMID: 24500202] |
| [4] | Bernard Martin et al. (2013) ComE/ComE~P interplay dictates activation or extinction status of pneumococcal X-state (competence). Molecular Microbiology 87(2):394-411. [PMID: 23216914] |
| [5] | Bernard Martin et al. (2010) Expression and maintenance of ComD-ComE, the two-component signal-transduction system that controls competence of Streptococcus pneumoniae. Molecular Microbiology 75(6):1513-28. [PMID: 20180906] |
| [6] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [7] | O Ween et al. (1999) Identification of DNA binding sites for ComE, a key regulator of natural competence in Streptococcus pneumoniae. Molecular Microbiology 33(4):817-27. [PMID: 10447890] |
| [8] | E V Pestova et al. (1996) Regulation of competence for genetic transformation in Streptococcus pneumoniae by an auto-induced peptide pheromone and a two-component regulatory system. Molecular Microbiology 21(4):853-62. [PMID: 8878046] |
| [9] | L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047] |