Detailed information NTG0000209

Experimentally validated

Overview

• Name: comE
• Type: Regulator
• Locus tag: SPD_RS10920
• Genome accession: NC_008533
• Coordinates: 2040743..2041495 (-)
• Length: 250 a.a.
• NCBI ID: WP_000866065.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae D39
• Function: activate transcription of early competence genes Competence regulation

Function

The comE gene encodes a response regulator that is phosphorylated by the histidine kinase ComD upon binding of the competence-stimulating peptide (CSP). ComE∼P is the active form of ComE, which recognizes and binds to a specific DNA motif, or ComE-box, upstream of early com genes and comX. By stimulating further transcription of early com genes, ComE∼P creates a positive amplification loop of the signal, which maintains the competent state for DNA uptake.

Genomic Context

Location: 2035743..2046495

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPD_RS12055 (SPD_2059)	-	2038176..2039779 (-)	1604	Protein_2017	YhgE/Pip family protein	-
SPD_RS10905 (SPD_2060)	-	2039958..2040500 (+)	543	WP_001158266.1	TetR/AcrR family transcriptional regulator	-
SPD_RS10920 (SPD_2063)	comE	2040743..2041495 (-)	753	WP_000866065.1	competence system response regulator transcription factor ComE	Regulator
SPD_RS10925 (SPD_2064)	comD/comD1	2041492..2042817 (-)	1326	WP_000362880.1	competence system sensor histidine kinase ComD	Regulator
SPD_RS10930 (SPD_2065)	comC/comC1	2042838..2042963 (-)	126	WP_000799689.1	competence-stimulating peptide ComC	Regulator
SPD_RS10940 (SPD_2067)	rlmH	2043245..2043724 (-)	480	WP_000695929.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
SPD_RS10945 (SPD_2068)	htrA	2043907..2045088 (+)	1182	WP_000681597.1	S1C family serine protease	Regulator
SPD_RS10950 (SPD_2069)	spo0J	2045146..2045904 (+)	759	WP_000410378.1	ParB/RepB/Spo0J family partition protein	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comE	comM	positive effect
comM	cbpD	negative effect
cbpD	lytA	positive effect
cbpD	lytC	positive effect
comE	comW	positive effect
comE	comA	positive effect
comE	comB	positive effect
comE	comE	positive effect
comE	comX/comX1	positive effect
comE	comD/comD1	positive effect
comE	comX/comX2	positive effect
comE	comC/comC1	positive effect
comD/comD1	comE	positive effect
stkP	comE	positive effect
ccpA	comE	positive effect
comW	comX/comX1	positive effect
comX/comX1	late competence genes	positive effect
clpE	comX/comX1	negative effect
clpP	comX/comX1	negative effect
comW	comX/comX2	positive effect
comX/comX2	late competence genes	positive effect
clpE	comX/comX2	negative effect
clpP	comX/comX2	negative effect
mecA	comW	negative effect
clpC	comW	negative effect
clpP	comW	negative effect
comA	comC/comC1	positive effect
comC/comC1	comD/comD1	positive effect
ccpA	comC/comC1	positive effect
comB	comC/comC1	positive effect
htrA	comC/comC1	negative effect
ciaR	comC/comC1	negative effect
ciaH	comC/comC1	negative effect
ccpA	comD/comD1	positive effect
comX/comX2	late competence genes	positive effect
comX/comX1	late competence genes	positive effect
htrA	comEA/celA/cilE	negative effect
htrA	comEC/celB	negative effect
ciaR	htrA	positive effect
ciaH	htrA	positive effect

Sequence

Protein

• Length: 250 a.a.
• Molecular weight: 29958.31 Da
• Isoelectric Point: 6.5073

>NTDB_id=209 SPD_RS10920 WP_000866065.1 2040743..2041495(-) (comE) [Streptococcus pneumoniae D39]
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLDIDIHGIEKKGFEVAQLIRHYNP
YAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILY
IETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKL
KDILEKKSQK

Nucleotide

• Length: 753 bp

>NTDB_id=209 SPD_RS10920 WP_000866065.1 2040743..2041495(-) (comE) [Streptococcus pneumoniae D39]
ATGAAAGTTTTAATTTTAGAAGATGTTATTGAACATCAAGTGAGACTAGAGAGAATATTGGATGAAATTTCGAAAGAATC
GAATATTCCAATATCATACAAGACAACGGGAAAAGTCCGTGAATTTGAAGAATACATTGAAAATGATGAAGTAAATCAGC
TTTATTTCCTAGATATCGATATTCATGGAATTGAGAAAAAGGGATTTGAAGTGGCTCAGCTCATTCGTCATTACAATCCT
TACGCTATTATCGTCTTTATCACTAGTCGATCAGAGTTTGCGACTCTAACATATAAATACCAGGTATCAGCCCTAGATTT
TGTTGATAAGGATATCAATGATGAGATGTTTAAGAAGAGAATTGAGCAAAATATCTTCTACACGAAGAGTATGTTACTTG
AAAATGAAGATGTTGTAGATTATTTCGACTACAATTACAAGGGAAATGATTTAAAAATTCCTTACCATGATATTTTGTAT
ATTGAAACAACAGGGGTATCTCATAAATTGCGCATTATTGGTAAGAATTTTGCAAAAGAGTTTTATGGTACCATGACAGA
TATTCAGGAAAAGGACAAACATACTCAGCGATTTTATTCTCCTCACAAGTCATTTTTGGTAAATATAGGCAATATCAGAG
AAATTGATCGAAAAAACTTAGAAATTGTTTTCTATGAAGACCATCGTTGTCCTATTTCAAGATTAAAAATTAGAAAATTA
AAAGATATTTTAGAGAAAAAATCTCAAAAGTGA

Domains

Predicted by InterproScan.

• LytTr DNA-binding domain (LytTR) (151-244)

• Response regulator receiver domain (Response_reg) (3-121)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Streptococcus pneumoniae TIGR4	100	100	1
comE	Streptococcus pneumoniae R6	100	100	1
comE	Streptococcus pneumoniae Rx1	100	100	1
comE	Streptococcus mitis SK321	99.2	100	0.992
comE	Streptococcus mitis NCTC 12261	98.4	100	0.984
comE	Streptococcus infantis strain Atu-4	91.2	100	0.912
comE/comE1	Streptococcus gordonii str. Challis substr. CH1	62.8	100	0.628
comE/comE2	Streptococcus gordonii strain NCTC7865	62.8	100	0.628
comE/blpR	Streptococcus mutans UA159	41.296	98.8	0.408
comE/comE2	Streptococcus equinus JB1	35.039	100	0.365

References

• [1]: Germán E Piñas et al. (2018) Crosstalk between the serine/threonine kinase StkP and the response regulator ComE controls the stress response and intracellular survival of Streptococcus pneumoniae. PLoS Pathogens 14(6):e1007118. [PMID: 29883472]
• [2]: Yuqiang Zheng et al. (2017) ComE, an Essential Response Regulator, Negatively Regulates the Expression of the Capsular Polysaccharide Locus and Attenuates the Bacterial Virulence in Streptococcus pneumoniae. Frontiers in Microbiology 8:277. [PMID: 28326061]
• [3]: Marion Boudes et al. (2014) Structural insights into the dimerization of the response regulator ComE from Streptococcus pneumoniae. Nucleic Acids Research 42(8):5302-13. [PMID: 24500202]
• [4]: Bernard Martin et al. (2013) ComE/ComE~P interplay dictates activation or extinction status of pneumococcal X-state (competence). Molecular Microbiology 87(2):394-411. [PMID: 23216914]
• [5]: Bernard Martin et al. (2010) Expression and maintenance of ComD-ComE, the two-component signal-transduction system that controls competence of Streptococcus pneumoniae. Molecular Microbiology 75(6):1513-28. [PMID: 20180906]
• [6]: Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980]
• [7]: O Ween et al. (1999) Identification of DNA binding sites for ComE, a key regulator of natural competence in Streptococcus pneumoniae. Molecular Microbiology 33(4):817-27. [PMID: 10447890]
• [8]: E V Pestova et al. (1996) Regulation of competence for genetic transformation in Streptococcus pneumoniae by an auto-induced peptide pheromone and a two-component regulatory system. Molecular Microbiology 21(4):853-62. [PMID: 8878046]
• [9]: L S Håvarstein et al. (1996) Identification of the streptococcal competence-pheromone receptor. Molecular Microbiology 21(4):863-9. [PMID: 8878047]