Detailed information
Overview
| Name | ciaH | Type | Regulator |
| Locus tag | SPD_RS03780 | Genome accession | NC_008533 |
| Coordinates | 715488..716822 (+) | Length | 444 a.a. |
| NCBI ID | WP_000491790.1 | Uniprot ID | Q7B3G0 |
| Organism | Streptococcus pneumoniae D39 | ||
| Function | repress competence development; post-transcriptional repression of CSP production Competence regulation |
||
Function
CiaRH negatively regulates competence development by controlling the expression of csRNAs (cia-dependent small RNAs) that target comC. These csRNAs post-transcriptionally regulate comC, thereby influencing the initiation of the competence cascade. A hyperactive CiaRH system might suppress competence development by increasing the level of HtrA at the outer surface of the cytoplasmic membrane.
Genomic Context
Location: 710488..721822
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPD_RS03760 (SPD_0698) | - | 710762..711631 (+) | 870 | WP_000795797.1 | putative PEP-binding protein | - |
| SPD_RS03765 (SPD_0699) | - | 711606..712046 (+) | 441 | WP_001856133.1 | ASCH domain-containing protein | - |
| SPD_RS03770 (SPD_0700) | - | 712169..714715 (+) | 2547 | WP_001149118.1 | M1 family metallopeptidase | - |
| SPD_RS03775 (SPD_0701) | ciaR | 714824..715498 (+) | 675 | WP_000590640.1 | two-component system response regulator CiaR | Regulator |
| SPD_RS03780 (SPD_0702) | ciaH | 715488..716822 (+) | 1335 | WP_000491790.1 | two-component system sensor histidine kinase CiaH | Regulator |
| SPD_RS03785 (SPD_0703) | - | 716856..717143 (-) | 288 | WP_001145225.1 | DUF3270 domain-containing protein | - |
| SPD_RS03790 (SPD_0704) | - | 717283..718212 (+) | 930 | WP_000411867.1 | peptidase U32 family protein | - |
| SPD_RS03795 (SPD_0705) | - | 718412..720862 (+) | 2451 | WP_000848689.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| ciaH | comC/comC1 | negative effect |
| comC/comC1 | comD/comD1 | positive effect |
| comD/comD1 | comE | positive effect |
| comE | comM | positive effect |
| comM | cbpD | negative effect |
| cbpD | lytA | positive effect |
| cbpD | lytC | positive effect |
| comE | comW | positive effect |
| comW | comX/comX1 | positive effect |
| comW | comX/comX2 | positive effect |
| mecA | comW | negative effect |
| clpC | comW | negative effect |
| clpP | comW | negative effect |
| comE | comA | positive effect |
| comA | comC/comC1 | positive effect |
| comE | comB | positive effect |
| comB | comC/comC1 | positive effect |
| comE | comE | positive effect |
| comE | comX/comX1 | positive effect |
| comE | comD/comD1 | positive effect |
| comE | comX/comX2 | positive effect |
| comE | comC/comC1 | positive effect |
| stkP | comE | positive effect |
| ccpA | comE | positive effect |
| comX/comX1 | late competence genes | positive effect |
| clpE | comX/comX1 | negative effect |
| clpP | comX/comX1 | negative effect |
| ccpA | comD/comD1 | positive effect |
| comX/comX2 | late competence genes | positive effect |
| clpE | comX/comX2 | negative effect |
| clpP | comX/comX2 | negative effect |
| ccpA | comC/comC1 | positive effect |
| htrA | comC/comC1 | negative effect |
| ciaR | comC/comC1 | negative effect |
| comX/comX2 | late competence genes | positive effect |
| comX/comX1 | late competence genes | positive effect |
| htrA | comEA/celA/cilE | negative effect |
| htrA | comEC/celB | negative effect |
| ciaR | htrA | positive effect |
| ciaH | htrA | positive effect |
Sequence
Protein
Download Length: 444 a.a. Molecular weight: 50673.39 Da Isoelectric Point: 9.1661
MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYTSVDDKLHGLSENPQAVIQLAINRATEEIKDLENAR
ADASKVEIKPNVSSNTEVILFDKDFTQLLSGNRFLGLDKIKLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTN
IKYAAVLINTSQLEQASQKHEQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVENASHELRTPLAVLQNRLE
TLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRDDGIKPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRI
HRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISATDRNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGF
GLGLSLAKQIVDALKGTVTVKDNKPKGTIFEVKIAIQTPSKKKK
Nucleotide
Download Length: 1335 bp
ATGTTCAGTAAACTTAAAAAAACATGGTATGCGGATGACTTTAGTTATTTTATCCGCAACTTCGGTGTCTTCACCCTGAT
TTTTTCTACAATGACTCTGATTATTTTACAAGTCATGCATTCGAGTCTTTATACTTCGGTGGACGATAAGCTTCATGGAC
TGAGTGAAAATCCTCAAGCAGTTATTCAGCTGGCTATAAATAGGGCAACAGAAGAGATTAAAGATTTAGAAAATGCTAGG
GCGGACGCTAGTAAAGTAGAAATAAAACCTAATGTCAGTTCCAATACGGAAGTCATTCTCTTTGATAAGGACTTTACTCA
ACTTCTTTCTGGAAATCGATTTTTGGGCTTGGATAAGATTAAGTTAGAAAAGAAAGAACTAGGACATATCTACCAGATTC
AGGTTTTTAATAGCTATGGGCAGGAAGAAATCTATCGTGTGATTTTGATGGAGACCAATATTAGTTCGGTTTCAACCAAT
ATCAAGTATGCTGCTGTCTTGATTAATACCAGTCAGTTGGAGCAGGCTAGTCAAAAGCATGAGCAATTGATTGTGGTCGT
GATGGCTAGTTTCTGGATTTTGTCTTTACTTGCCAGTCTCTATCTAGCTAGGGTCAGTGTTAGGCCCCTGCTTGAGAGTA
TGCAGAAGCAACAGTCTTTTGTGGAAAATGCCAGTCATGAGTTACGAACTCCACTCGCAGTTTTGCAAAATCGCTTAGAG
ACCCTTTTTCGTAAGCCAGAAGCTACCATTATGGATGTGAGCGAAAGCATTGCATCGAGTTTGGAAGAAGTCCGAAATAT
GCGTTTTTTAACGACAAGCTTGCTGAACTTAGCTCGGAGAGATGATGGGATTAAGCCGGAGCTTGCAGAAGTTCCAACTA
GCTTTTTTAATACAACTTTCACAAACTATGAGATGATTGCTTCGGAAAATAATCGTGTCTTCCGTTTTGAAAATCGTATC
CATCGAACAATTGTCACAGATCAGCTTCTTCTGAAACAACTGATGACCATTCTTTTCGATAATGCCGTCAAGTATACTGA
GGAGGATGGTGAAATTGATTTTCTTATCTCGGCGACCGATCGCAATCTTTATTTACTTGTTTCTGATAATGGAATCGGTA
TTTCGACAGAAGATAAAAAGAAAATTTTTGACCGTTTTTATCGAGTAGACAAGGCTAGAACCCGGCAAAAAGGTGGTTTT
GGTTTAGGATTATCCCTAGCCAAGCAAATTGTAGATGCTCTAAAAGGAACTGTTACTGTCAAAGATAATAAACCCAAGGG
AACAATCTTTGAAGTGAAGATTGCCATTCAGACACCATCTAAAAAGAAAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ciaH | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| ciaH | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| ciaH | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| ciaH | Streptococcus mutans UA159 |
55.632 |
100 |
0.556 |
Multiple sequence alignment
References
| [1] | Anke Laux et al. (2015) Control of competence by related non-coding csRNAs in Streptococcus pneumoniae R6. Frontiers in Genetics 6:246. [PMID: 26257773] |
| [2] | Anke Schnorpfeil et al. (2013) Target evaluation of the non-coding csRNAs reveals a link of the two-component regulatory system CiaRH to competence control in Streptococcus pneumoniae R6. Molecular Microbiology 89(2):334-49. [PMID: 23710838] |
| [3] | Marco Cassone et al. (2012) The HtrA protease from Streptococcus pneumoniae digests both denatured proteins and the competence-stimulating peptide. The Journal of Biological Chemistry 287(46):38449-59. [PMID: 23012372] |
| [4] | Alexander Halfmann et al. (2011) Activity of the two-component regulatory system CiaRH in Streptococcus pneumoniae R6. Journal of Molecular Microbiology And Biotechnology 20(2):96-104. [PMID: 21422763] |
| [5] | Miriam Müller et al. (2011) Effect of new alleles of the histidine kinase gene ciaH on the activity of the response regulator CiaR in Streptococcus pneumoniae R6. Microbiology (Reading, England) 157(Pt 11):3104-3112. [PMID: 21903754] |
| [6] | Patrick Marx et al. (2010) Identification of genes for small non-coding RNAs that belong to the regulon of the two-component regulatory system CiaRH in Streptococcus. BMC Genomics 11:661. [PMID: 21106082] |
| [7] | Alexander Halfmann et al. (2007) Identification of the genes directly controlled by the response regulator CiaR in Streptococcus pneumoniae: five out of 15 promoters drive expression of small non-coding RNAs. Molecular Microbiology 66(1):110-26. [PMID: 17725562] |
| [8] | M E Sebert et al. (2005) Pneumococcal HtrA protease mediates inhibition of competence by the CiaRH two-component signaling system. Journal of Bacteriology 187(12):3969-79. [PMID: 15937159] |
| [9] | Yasser Musa Ibrahim et al. (2004) Control of virulence by the two-component system CiaR/H is mediated via HtrA, a major virulence factor of Streptococcus pneumoniae. Journal of Bacteriology 186(16):5258-66. [PMID: 15292127] |
| [10] | Dorothea Zähner et al. (2002) The ciaR/ciaH regulatory network of Streptococcus pneumoniae. Journal of Molecular Microbiology And Biotechnology 4(3):211-6. [PMID: 11931549] |
| [11] | M E Sebert et al. (2002) Microarray-based identification of htrA, a Streptococcus pneumoniae gene that is regulated by the CiaRH two-component system and contributes to nasopharyngeal colonization. Infection And Immunity 70(8):4059-67. [PMID: 12117912] |
| [12] | Philippe Giammarinaro et al. (1999) Genetic and physiological studies of the CiaH-CiaR two-component signal-transducing system involved in cefotaxime resistance and competence of Streptococcus pneumoniae. Microbiology (Reading, England) 145 ( Pt 8):1859-1869. [PMID: 10463152] |