Detailed information NTG0000365

Experimentally validated

Overview

• Name: hdrM
• Type: Regulator
• Locus tag: SMU_RS08505
• Genome accession: NC_004350
• Coordinates: 1753859..1754545 (+)
• Length: 228 a.a.
• NCBI ID: WP_002262670.1
• Uniprot ID: -
• Organism: Streptococcus mutans UA159
• Function: repress competence development; negative regulate HdrR activity Competence regulation

Function

The primary function of the HdrRM system is to regulate the late competence genes together with various bacteriocins. This occurs independently of the ComCDE system, even though both systems regulate nearly identical genes. HdrM acts as a negative regulator of HdrR activity. Expression of comR, comX and late competence genes is strongly stimulated either when mutating the HdrM membranebound protein, or when HdrR is overexpressed.

Genomic Context

Location: 1748859..1759545

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMU_RS08485	-	1750858..1751079 (+)	222	WP_019313410.1	hypothetical protein	-
SMU_RS08490 (SMU.1852)	-	1751479..1752423 (+)	945	WP_002262667.1	magnesium transporter CorA family protein	-
SMU_RS08495 (SMU.1853)	-	1752705..1753367 (+)	663	WP_002262668.1	DUF1129 domain-containing protein	-
SMU_RS08500 (SMU.1854)	hdrR	1753506..1753862 (+)	357	WP_002262669.1	LytTR family transcriptional regulator HdrR	Regulator
SMU_RS08505 (SMU.1855)	hdrM	1753859..1754545 (+)	687	WP_002262670.1	hdrR negative regulator HdrM	Regulator
SMU_RS08510 (SMU.1856c)	-	1754553..1755272 (-)	720	WP_002262671.1	TraX family protein	-
SMU_RS08515 (SMU.1858)	rpsR	1755591..1755830 (-)	240	WP_000068664.1	30S ribosomal protein S18	-
SMU_RS08520 (SMU.1859)	ssbA	1755859..1756353 (-)	495	WP_002261867.1	single-stranded DNA-binding protein	Machinery gene
SMU_RS08525 (SMU.1860)	rpsF	1756371..1756661 (-)	291	WP_002261866.1	30S ribosomal protein S6	-
SMU_RS08530 (SMU.1861c)	-	1756817..1757062 (-)	246	WP_002263367.1	hypothetical protein	-
SMU_RS08535 (SMU.1862)	-	1757367..1757570 (+)	204	WP_002263366.1	hypothetical protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
hdrM	hdrR	negative effect
hdrR	comX/sigX	positive effect
comX/sigX	late competence genes	positive effect
comX/sigX	late competence genes	positive effect
scnR	comX/sigX	positive effect
mecA	comX/sigX	negative effect
clpC	comX/sigX	negative effect
comR	comX/sigX	positive effect
clpP	comX/sigX	negative effect
XrpA	comX/sigX	negative effect
scnK	comX/sigX	positive effect
comS	comX/sigX	positive effect
comD/blpH	comX/sigX	positive effect
vicK	comX/sigX	negative effect
comE/blpR	comX/sigX	positive effect
scnC	comX/sigX	positive effect
brsR	comX/sigX	positive effect
cipB	comX/sigX	positive effect
vicR	comX/sigX	negative effect
comC/blpC	comX/sigX	positive effect
hdrR	comR	positive effect
comR	comS	positive effect
cipB	comR	positive effect
XrpA	comR	negative effect
comS	comS	positive effect
oppD	comS	positive effect
cipB	comS	positive effect
XrpA	comS	negative effect
comD/blpH	comE/blpR	positive effect
comE/blpR	comD/blpH	positive effect
comE/blpR	comC/blpC	positive effect
comE/blpR	comA/nlmT	positive effect
comE/blpR	comE/blpR	positive effect
comE/blpR	comB/nlmE	positive effect
vicR	comE/blpR	negative effect
vicK	comE/blpR	negative effect
vicR	comD/blpH	negative effect
vicR	comC/blpC	negative effect
vicK	comD/blpH	negative effect
vicK	comC/blpC	negative effect
comC/blpC	comD/blpH	positive effect
comA/nlmT	comC/blpC	positive effect
comB/nlmE	comC/blpC	positive effect
ciaH	comC/blpC	positive effect
sepM	comC/blpC	positive effect
brsM	brsR	negative effect

Sequence

Protein

• Length: 228 a.a.
• Molecular weight: 26110.18 Da
• Isoelectric Point: 6.8478

>NTDB_id=365 SMU_RS08505 WP_002262670.1 1753859..1754545(+) (hdrM) [Streptococcus mutans UA159]
MKKNYFWYGLLGLLALYLITIAFIPGFHIFFSNMLMLALFFMLIALSNRSIFFFFLALGFLSIYLKDIFHFDYSTGPLFT
GIIIIGVILNSFLKPHYSYSYKGNHYFNMKQHANYIDNETDVFLKTLFSENTSYVTSQELNKIIIDTKFGEQSVDLSQAQ
FMTDSPEIHIDVSFGETNLRIPNNWKIINKTHSPFASISFSGFPSTNGDFINVTLTGTVAMGSLNIQY

Nucleotide

• Length: 687 bp

>NTDB_id=365 SMU_RS08505 WP_002262670.1 1753859..1754545(+) (hdrM) [Streptococcus mutans UA159]
ATGAAAAAAAATTATTTTTGGTACGGTCTGCTTGGGCTTCTCGCACTTTACCTTATTACTATTGCTTTTATCCCGGGATT
TCATATTTTCTTTAGCAACATGTTGATGTTGGCCCTGTTCTTTATGTTAATAGCTTTGAGTAACAGGAGTATCTTCTTTT
TCTTTCTAGCCTTAGGTTTTCTTAGTATCTACTTGAAAGATATCTTTCATTTTGACTATTCTACCGGACCGCTTTTTACG
GGTATAATCATTATCGGCGTTATTTTAAACAGTTTCCTCAAACCACACTATTCTTATTCTTATAAAGGAAATCATTATTT
TAATATGAAACAACATGCTAACTACATTGATAACGAAACAGATGTCTTTTTAAAAACACTTTTTTCTGAAAATACCAGTT
ATGTGACTTCTCAAGAATTAAATAAAATTATTATTGATACTAAGTTTGGAGAACAATCTGTTGATCTCTCTCAAGCTCAA
TTTATGACAGATTCTCCCGAAATTCATATAGATGTTAGCTTTGGTGAAACCAATCTGCGTATTCCAAACAACTGGAAAAT
CATCAATAAAACTCACTCCCCCTTTGCTTCCATTTCATTTTCAGGTTTTCCTAGCACAAATGGTGATTTTATTAACGTTA
CATTGACTGGAACAGTGGCTATGGGATCTCTAAACATTCAATATTAA

Domains

Predicted by InterProScan.

• Cell wall-active antibiotics response 4TMS YvqF (LiaF-like_C) (128-205)

References

• [1]: Zhoujie Xie et al. (2020) Regulatory control of the Streptococcus mutans HdrRM LytTR Regulatory System functions via a membrane sequestration mechanism. Molecular Microbiology 114(4):681-693. [PMID: 32706915]
• [2]: Toshinori Okinaga et al. (2010) The hdrRM operon of Streptococcus mutans encodes a novel regulatory system for coordinated competence development and bacteriocin production. Journal of Bacteriology 192(7):1844-52. [PMID: 20118256]
• [3]: T Okinaga et al. (2010) Examination of the hdrRM regulon yields insight into the competence system of Streptococcus mutans. Molecular Oral Microbiology 25(3):165-77. [PMID: 20536745]
• [4]: Justin Merritt et al. (2007) Genetic characterization of the hdrRM operon: a novel high-cell-density-responsive regulator in Streptococcus mutans. Microbiology (Reading, England) 153(Pt 8):2765-2773. [PMID: 17660440]