Detailed information    

experimental Experimentally validated

Overview

Name   cipB   Type   Regulator
Locus tag   SMU_RS08695 Genome accession   NC_004350
Coordinates   1794511..1794741 (-) Length   76 a.a.
NCBI ID   WP_002265368.1    Uniprot ID   Q8DS95
Organism   Streptococcus mutans UA159     
Function   indirect induction of ComX; activation of comRS system   
Competence regulation

Function

Although the mechanism is unknown, the activity of CipB is required for the indirect induction of SigX.


Genomic Context

Location: 1789511..1799741
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMU_RS08670 (SMU.1905c) - 1789720..1789908 (-) 189 WP_002263743.1 Blp family class II bacteriocin -
  SMU_RS08675 (SMU.1906c) - 1790072..1790284 (-) 213 WP_002263744.1 Blp family class II bacteriocin -
  SMU_RS09970 (SMU.1908c) - 1790689..1790853 (-) 165 WP_002265308.1 hypothetical protein -
  SMU_RS10085 - 1791293..1791505 (+) 213 Protein_1688 IS3 family transposase -
  SMU_RS08680 (SMU.1909c) - 1791628..1792032 (-) 405 WP_002263912.1 hypothetical protein -
  SMU_RS08685 (SMU.1910c) - 1792179..1792598 (-) 420 WP_002263913.1 hypothetical protein -
  SMU_RS08690 (SMU.1913c) - 1793979..1794380 (-) 402 WP_002310604.1 hypothetical protein -
  SMU_RS08695 (SMU.1914c) cipB 1794511..1794741 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  SMU_RS08700 (SMU.1915) comC/blpC 1795008..1795148 (+) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  SMU_RS08705 (SMU.1916) comD/blpH 1795290..1796615 (-) 1326 WP_002262113.1 sensor histidine kinase Regulator
  SMU_RS08710 (SMU.1917) comE/blpR 1796612..1797364 (-) 753 WP_002262114.1 response regulator transcription factor Regulator
  SMU_RS08715 (SMU.1918) - 1797836..1798474 (-) 639 WP_002262115.1 VTT domain-containing protein -
  SMU_RS08720 (SMU.1919) - 1798521..1799147 (-) 627 WP_002262116.1 hypothetical protein -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  cipB comX/sigX positive effect
  comX/sigX late competence genes positive effect
  comX/sigX late competence genes positive effect
  scnR comX/sigX positive effect
  hdrR comX/sigX positive effect
  hdrR comR positive effect
  hdrM hdrR negative effect
  mecA comX/sigX negative effect
  clpC comX/sigX negative effect
  comR comX/sigX positive effect
  comR comS positive effect
  cipB comR positive effect
  XrpA comR negative effect
  clpP comX/sigX negative effect
  XrpA comX/sigX negative effect
  XrpA comS negative effect
  scnK comX/sigX positive effect
  comS comX/sigX positive effect
  comS comS positive effect
  oppD comS positive effect
  cipB comS positive effect
  comD/blpH comX/sigX positive effect
  comD/blpH comE/blpR positive effect
  vicR comD/blpH negative effect
  comE/blpR comD/blpH positive effect
  vicK comD/blpH negative effect
  comC/blpC comD/blpH positive effect
  vicK comX/sigX negative effect
  vicK comC/blpC negative effect
  vicK comE/blpR negative effect
  comE/blpR comX/sigX positive effect
  comE/blpR comC/blpC positive effect
  comE/blpR comA/nlmT positive effect
  comE/blpR comE/blpR positive effect
  comE/blpR comB/nlmE positive effect
  vicR comE/blpR negative effect
  scnC comX/sigX positive effect
  brsR comX/sigX positive effect
  brsM brsR negative effect
  vicR comX/sigX negative effect
  vicR comC/blpC negative effect
  comC/blpC comX/sigX positive effect
  comA/nlmT comC/blpC positive effect
  comB/nlmE comC/blpC positive effect
  ciaH comC/blpC positive effect
  sepM comC/blpC positive effect

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7262.08 Da        Isoelectric Point: 3.7781

>NTDB_id=357 SMU_RS08695 WP_002265368.1 1794511..1794741(-) (cipB) [Streptococcus mutans UA159]
MNTQAFEQFNVMDNEALSAVEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=357 SMU_RS08695 WP_002265368.1 1794511..1794741(-) (cipB) [Streptococcus mutans UA159]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTGTTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-68)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Michael Reck et al. (2015) The Alternative Sigma Factor SigX Controls Bacteriocin Synthesis and Competence, the Two Quorum Sensing Regulated Traits in Streptococcus mutans. PLoS Genetics 11(7):e1005353. [PMID: 26158727]
[2] Delphine Dufour et al. (2011) Regulation of the competence pathway as a novel role associated with a streptococcal bacteriocin. Journal of Bacteriology 193(23):6552-9. [PMID: 21984782]
[3] Julie A Perry et al. (2009) Peptide alarmone signalling triggers an auto-active bacteriocin necessary for genetic competence. Molecular Microbiology 72(4):905-17. [PMID: 19400789]
[4] Jan R van der Ploeg (2005) Regulation of bacteriocin production in Streptococcus mutans by the quorum-sensing system required for development of genetic competence. Journal of Bacteriology 187(12):3980-9. [PMID: 15937160]
[5] John D F Hale et al. (2005) Bacteriocin (mutacin) production by Streptococcus mutans genome sequence reference strain UA159: elucidation of the antimicrobial repertoire by genetic dissection. Applied And Environmental Microbiology 71(11):7613-7. [PMID: 16269816]