NTDB

Overview

Name	comD/blpH	Type	Regulator
Locus tag	SMU_RS08705	Genome accession	NC_004350
Coordinates	1795290..1796615 (-)	Length	441 a.a.
NCBI ID	WP_002262113.1	Uniprot ID	Q8DS94
Organism	Streptococcus mutans UA159
Function	phosphorylation of ComE; regulation of comX expression Competence regulation

Function

An homolog of the comCDE and blpCHR locus of S. pneumoniae, modulates competence and controls production of bacteriocin-like peptides. ComD, a membrane-bound histidine kinase, is the receptor of the competence-stimulating peptide (CSP). Binding of CSP to its associated ComD receptor will result in autophosphorylation of ComD and subsequent transfer of the phosphoryl group to ComE. This activation initiates the transcription of early competence genes.

Genomic Context

Location: 1790290..1801615

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMU_RS09970 (SMU.1908c)	-	1790689..1790853 (-)	165	WP_002265308.1	hypothetical protein	-
SMU_RS10085	-	1791293..1791505 (+)	213	Protein_1688	IS3 family transposase	-
SMU_RS08680 (SMU.1909c)	-	1791628..1792032 (-)	405	WP_002263912.1	hypothetical protein	-
SMU_RS08685 (SMU.1910c)	-	1792179..1792598 (-)	420	WP_002263913.1	hypothetical protein	-
SMU_RS08690 (SMU.1913c)	-	1793979..1794380 (-)	402	WP_002310604.1	hypothetical protein	-
SMU_RS08695 (SMU.1914c)	cipB	1794511..1794741 (-)	231	WP_002265368.1	Blp family class II bacteriocin	Regulator
SMU_RS08700 (SMU.1915)	comC/blpC	1795008..1795148 (+)	141	WP_002267610.1	ComC/BlpC family leader-containing pheromone/bacteriocin	Regulator
SMU_RS08705 (SMU.1916)	comD/blpH	1795290..1796615 (-)	1326	WP_002262113.1	sensor histidine kinase	Regulator
SMU_RS08710 (SMU.1917)	comE/blpR	1796612..1797364 (-)	753	WP_002262114.1	response regulator transcription factor	Regulator
SMU_RS08715 (SMU.1918)	-	1797836..1798474 (-)	639	WP_002262115.1	VTT domain-containing protein	-
SMU_RS08720 (SMU.1919)	-	1798521..1799147 (-)	627	WP_002262116.1	hypothetical protein	-
SMU_RS08725 (SMU.1920)	der	1799222..1800532 (-)	1311	WP_002262117.1	ribosome biogenesis GTPase Der	-
SMU_RS08730 (SMU.1921)	dnaI	1800545..1801444 (-)	900	WP_002262118.1	primosomal protein DnaI	-

Regulatory network

Positive effect

Negative effect

Regulator	Target	Regulation
comD/blpH	comE/blpR	positive effect
comE/blpR	comD/blpH	positive effect
comD/blpH	comX/sigX	positive effect
vicR	comD/blpH	negative effect
vicK	comD/blpH	negative effect
comC/blpC	comD/blpH	positive effect
comE/blpR	comC/blpC	positive effect
comC/blpC	comX/sigX	positive effect
comA/nlmT	comC/blpC	positive effect
comB/nlmE	comC/blpC	positive effect
vicK	comC/blpC	negative effect
ciaH	comC/blpC	positive effect
vicR	comC/blpC	negative effect
sepM	comC/blpC	positive effect
comE/blpR	comA/nlmT	positive effect
comE/blpR	comX/sigX	positive effect
comX/sigX	late competence genes	positive effect
scnR	comX/sigX	positive effect
hdrR	comX/sigX	positive effect
mecA	comX/sigX	negative effect
clpC	comX/sigX	negative effect
comR	comX/sigX	positive effect
clpP	comX/sigX	negative effect
XrpA	comX/sigX	negative effect
scnK	comX/sigX	positive effect
comS	comX/sigX	positive effect
vicK	comX/sigX	negative effect
scnC	comX/sigX	positive effect
brsR	comX/sigX	positive effect
cipB	comX/sigX	positive effect
vicR	comX/sigX	negative effect
comE/blpR	comE/blpR	positive effect
comE/blpR	comB/nlmE	positive effect
vicR	comE/blpR	negative effect
vicK	comE/blpR	negative effect
comX/sigX	late competence genes	positive effect
hdrR	comR	positive effect
hdrM	hdrR	negative effect
comR	comS	positive effect
cipB	comR	positive effect
XrpA	comR	negative effect
XrpA	comS	negative effect
comS	comS	positive effect
oppD	comS	positive effect
cipB	comS	positive effect
brsM	brsR	negative effect

Sequence

Protein

Download Length: 441 a.a. Molecular weight: 50540.70 Da Isoelectric Point: 9.8211

                                >NTDB_id=54 SMU_RS08705 WP_002262113.1 1795290..1796615(-) (comD/blpH) [Streptococcus mutans UA159]

MNEALMILSNGLLTYLTVLFLLFLFSKVSNVTLSKKELTLFSISNFLIMIAVTMVNVNLFYPAEPLYFIALSIYLNRQNS

LSLNIFYGLLPVASSDLFRRAIIFFILDGTQGIVMGSSIITTYMIEFAGIALSYLFLSVFNVDIGRLKDSLTKMKVKKRL

IPMNITMLLYYLLIQVLYVIESYNVIPTLKFRKFVVIVYLILFLILISFLSQYTKQKVQNEIMAQKEAQIRNITQYSQQI

ESLYKDIRSFRHDYLNILTSLRLGIENKDLASIEKIYHQILEKTGHQLQDTRYNIGHLANIQNDAVKGILSAKILEAQNK

KIAVNVEVSSKIQLPEMELLDFITILSILCDNAIEAAFESLNPEIQLAFFKKNGSIVFIIQNSTKEKQIDVSKIFKENYS

TKGSNRGIGLAKVNHILEHYPKTSLQTSNHHHLFKQLLIIK

Nucleotide

Download Length: 1326 bp

                                >NTDB_id=54 SMU_RS08705 WP_002262113.1 1795290..1796615(-) (comD/blpH) [Streptococcus mutans UA159]

ATGAATGAAGCCTTAATGATACTTTCAAATGGTTTATTAACTTATCTAACCGTTCTATTTCTCTTGTTTCTATTTTCTAA

GGTAAGTAATGTCACTTTATCGAAAAAGGAATTAACTCTTTTTTCGATAAGCAATTTTCTGATAATGATTGCTGTTACGA

TGGTGAACGTAAACCTGTTTTATCCTGCAGAGCCTCTTTATTTTATAGCTTTATCAATTTATCTTAATAGACAGAATAGT

CTTTCTCTAAATATATTTTATGGTCTGCTGCCTGTTGCCAGTTCTGACTTGTTTAGGCGGGCAATCATATTCTTTATCTT

GGATGGAACTCAAGGAATTGTAATGGGCAGTAGCATTATAACCACCTATATGATCGAGTTTGCAGGAATAGCGCTAAGTT

ACCTCTTTCTCAGTGTGTTCAATGTTGATATTGGTCGACTTAAAGATAGTTTGACCAAGATGAAGGTCAAAAAACGCTTG

ATTCCAATGAATATTACTATGCTTCTATACTACCTTTTAATACAGGTATTGTATGTTATAGAGAGTTATAATGTGATACC

GACTTTAAAATTTCGTAAATTTGTCGTTATTGTCTATCTTATTTTATTTTTGATTCTGATCTCATTTTTAAGCCAATATA

CCAAACAAAAGGTTCAAAATGAGATAATGGCACAAAAGGAAGCTCAGATTCGAAATATCACCCAGTATAGTCAGCAAATA

GAATCTCTTTACAAGGATATTCGAAGTTTCCGCCATGATTATCTGAATATTTTAACTAGCCTCAGATTAGGCATTGAAAA

TAAAGATTTAGCTAGTATTGAAAAGATTTACCATCAAATCTTAGAAAAAACAGGACATCAATTGCAGGATACCCGTTATA

ATATCGGCCATCTAGCTAATATTCAAAACGATGCTGTCAAGGGTATCTTGTCAGCAAAAATCTTAGAAGCTCAGAATAAA

AAGATTGCTGTCAATGTAGAAGTCTCAAGTAAAATACAACTGCCTGAGATGGAGTTGCTTGATTTCATTACCATACTTTC

TATCTTGTGTGATAATGCCATTGAGGCTGCTTTCGAATCATTAAATCCTGAAATTCAGTTAGCCTTTTTTAAGAAAAATG

GCAGTATAGTCTTTATCATTCAGAATTCCACCAAAGAAAAACAAATAGATGTGAGTAAAATTTTTAAAGAAAACTATTCC

ACTAAAGGCTCCAATCGCGGTATTGGTTTAGCAAAGGTGAATCATATTCTTGAACATTATCCCAAAACCAGTTTACAAAC

AAGCAATCATCATCATTTATTCAAGCAACTCCTAATAATAAAATAG

Domains

Predicted by InterProScan.

GHKL domain (HATPase_c_5)

(337-440)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8DS94

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comD/comD1	Streptococcus equinus JB1	42.291	94.583	0.4
comD/comD2	Streptococcus equinus JB1	37.785	97.46	0.368

Multiple sequence alignment

References

[1]	Chowdhury Raihan Bikash et al. (2018) Structure-Activity Relationships of the Competence Stimulating Peptide in Streptococcus mutans Reveal Motifs Critical for Membrane Protease SepM Recognition and ComD Receptor Activation. ACS Infectious Diseases 4(9):1385-1394. [PMID: 29990430]
[2]	Gaofeng Dong et al. (2016) Membrane Topology and Structural Insights into the Peptide Pheromone Receptor ComD, A Quorum-Sensing Histidine Protein Kinase of Streptococcus mutans. Scientific Reports 6:26502. [PMID: 27199267]
[3]	E W Bachtiar et al. (2016) Biological and Immunogenicity Property of IgY Anti S. mutans ComD. The Open Dentistry Journal 10:308-14. [PMID: 27386013]
[4]	David C I Hung et al. (2011) Characterization of DNA binding sites of the ComE response regulator from Streptococcus mutans. Journal of Bacteriology 193(14):3642-52. [PMID: 21602345]
[5]	Julie A Perry et al. (2009) Peptide alarmone signalling triggers an auto-active bacteriocin necessary for genetic competence. Molecular Microbiology 72(4):905-17. [PMID: 19400789]
[6]	Jens Kreth et al. (2007) The response regulator ComE in Streptococcus mutans functions both as a transcription activator of mutacin production and repressor of CSP biosynthesis. Microbiology (Reading, England) 153(Pt 6):1799-1807. [PMID: 17526837]
[7]	Y H Li et al. (2001) Natural genetic transformation of Streptococcus mutans growing in biofilms. Journal of Bacteriology 183(3):897-908. [PMID: 11208787]

Detailed information NTG0000054