Detailed information NTG0000356

Experimentally validated

Overview

• Name: XrpA
• Type: Regulator
• Locus tag: -
• Genome accession: NC_004350
• Coordinates: 1872134..1872343 (-)
• Length: 70 a.a.
• NCBI ID: -
• Uniprot ID: -
• Organism: Streptococcus mutans UA159
• Function: inhibition of comR; inhibition of XIP; inhibition of comX Competence regulation

Function

Transcriptomic and promoter activity assays in the ΔxrpA strain revealed an up-regulation of genes controlled by both the ComR- and ComX-regulons. An in vivo protein crosslinking and in vitro fluorescent polarization assays confirmed that the N-terminal region of XrpA were found to be sufficient in inhibiting ComR-XIP complex binding to ECom-box located within the comX promoter. This inhibitory activity was sufficient for decreases in PcomX activity, transformability and ComX accumulation.

Genomic Context

Location: 1867134..1877343

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMU_RS09065 (SMU.1993)	-	1868430..1869242 (-)	813	WP_002263429.1	metal ABC transporter permease	-
SMU_RS09070 (SMU.1994)	-	1869232..1869942 (-)	711	WP_002263428.1	metal ABC transporter ATP-binding protein	-
SMU_RS09075 (SMU.1995c)	-	1869945..1870391 (-)	447	WP_002263427.1	zinc-dependent MarR family transcriptional regulator	-
SMU_RS09080 (SMU.1996)	ispE	1871026..1871874 (-)	849	WP_002352368.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
SMU_RS09085 (SMU.1997)	comX/sigX	1872021..1872503 (-)	483	WP_002263585.1	sigma-70 family RNA polymerase sigma factor	Regulator
-	XrpA	1872134..1872343 (-)	210	-	-	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
XrpA	comS	negative effect
comS	comS	positive effect
comS	comX/sigX	positive effect
oppD	comS	positive effect
comR	comS	positive effect
cipB	comS	positive effect
comX/sigX	late competence genes	positive effect
scnR	comX/sigX	positive effect
hdrR	comX/sigX	positive effect
mecA	comX/sigX	negative effect
clpC	comX/sigX	negative effect
comR	comX/sigX	positive effect
clpP	comX/sigX	negative effect
XrpA	comX/sigX	negative effect
scnK	comX/sigX	positive effect
comD/blpH	comX/sigX	positive effect
vicK	comX/sigX	negative effect
comE/blpR	comX/sigX	positive effect
scnC	comX/sigX	positive effect
brsR	comX/sigX	positive effect
cipB	comX/sigX	positive effect
vicR	comX/sigX	negative effect
comC/blpC	comX/sigX	positive effect
cipB	comR	positive effect
hdrR	comR	positive effect
XrpA	comR	negative effect
comX/sigX	late competence genes	positive effect
hdrM	hdrR	negative effect
comD/blpH	comE/blpR	positive effect
vicR	comD/blpH	negative effect
comE/blpR	comD/blpH	positive effect
vicK	comD/blpH	negative effect
comC/blpC	comD/blpH	positive effect
vicK	comC/blpC	negative effect
vicK	comE/blpR	negative effect
comE/blpR	comC/blpC	positive effect
comE/blpR	comA/nlmT	positive effect
comE/blpR	comE/blpR	positive effect
comE/blpR	comB/nlmE	positive effect
vicR	comE/blpR	negative effect
brsM	brsR	negative effect
vicR	comC/blpC	negative effect
comA/nlmT	comC/blpC	positive effect
comB/nlmE	comC/blpC	positive effect
ciaH	comC/blpC	positive effect
sepM	comC/blpC	positive effect

Sequence

Protein

• Length: 70 a.a.
• Molecular weight: 8103.11 Da
• Isoelectric Point: 9.9673

>NTDB_id=356 1872134..1872343(-) (XrpA) [Streptococcus mutans UA159]
MIQNCISILRHVFLITLKMFCVSKKVRNVVLIECLMKKSVRLNTVCQVAVCNWMNIFYFVIVCLHINKV*

Nucleotide

• Length: 210 bp

>NTDB_id=356 1872134..1872343(-) (XrpA) [Streptococcus mutans UA159]
ATGATACAAAATTGTATATCTATTTTAAGACACGTTTTTCTAATTACATTAAAGATGTTTTGCGTCAGCAAGAAAGTCAG
AAACGTCGTTTTAATAGAATGTCTTATGAAGAAGTCGGTGAGATTGAACACTGTTTGTCAAGTGGCGGTATGCAATTGGA
TGAATATATTTTATTTCGTGATAGTTTGCTTGCATATAAACAAGGTCTGA

Domains

No domain identified.

References

• [1]: Justin Kaspar et al. (2018) Competence inhibition by the XrpA peptide encoded within the comX gene of Streptococcus mutans. Molecular Microbiology 109(3):345-364. [PMID: 29802741]
• [2]: Justin Kaspar et al. (2015) A unique open reading frame within the comX gene of Streptococcus mutans regulates genetic competence and oxidative stress tolerance. Molecular Microbiology 96(3):463-82. [PMID: 25620525]