Detailed information NTG0000371

Experimentally validated

Overview

• Name: scnC
• Type: Regulator
• Locus tag: -
• Genome accession: NC_004350
• Coordinates: 1086868..1087053 (-)
• Length: 62 a.a.
• NCBI ID: -
• Uniprot ID: -
• Organism: Streptococcus mutans UA159
• Function: regulate comX expression Competence regulation

Function

Deletion of the small scnC gene, or the whole scnC/R/K operon leads to a ~10-fold reduction in comX expression and natural transformation frequencies.

Genomic Context

Location: 1081868..1092053

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMU_RS05255 (SMU.1141c)	-	1082159..1082437 (-)	279	WP_002279684.1	UPF0223 family protein	-
SMU_RS05260 (SMU.1142c)	spx	1082430..1082843 (-)	414	WP_002263835.1	transcriptional regulator Spx	-
SMU_RS05265 (SMU.1143c)	-	1082904..1083824 (-)	921	WP_002262201.1	bifunctional riboflavin kinase/FAD synthetase	-
SMU_RS05270 (SMU.1144)	truB	1083855..1084736 (-)	882	WP_002262200.1	tRNA pseudouridine(55) synthase TruB	-
SMU_RS05275 (SMU.1145c)	scnK	1084846..1086159 (-)	1314	WP_002262199.1	sensor histidine kinase	Regulator
SMU_RS05280 (SMU.1146c)	scnR	1086160..1086849 (-)	690	WP_002262198.1	response regulator transcription factor	Regulator
-	scnC	1086868..1087053 (-)	186	-	-	Regulator
SMU_RS05285 (SMU.1148)	-	1087024..1087932 (+)	909	WP_002262197.1	ABC transporter ATP-binding protein	-
SMU_RS05290 (SMU.1149)	-	1087932..1088672 (+)	741	WP_002262196.1	ABC transporter permease	-
SMU_RS05295 (SMU.1150)	-	1088669..1089397 (+)	729	WP_002262195.1	ABC transporter permease	-
SMU_RS05300 (SMU.1151c)	-	1089516..1090880 (-)	1365	WP_002262194.1	DUF438 domain-containing protein	-
SMU_RS05305 (SMU.1152c)	-	1090880..1091113 (-)	234	WP_002262193.1	DUF1858 domain-containing protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
scnC	comX/sigX	positive effect
comX/sigX	late competence genes	positive effect
comX/sigX	late competence genes	positive effect
scnR	comX/sigX	positive effect
hdrR	comX/sigX	positive effect
hdrR	comR	positive effect
hdrM	hdrR	negative effect
mecA	comX/sigX	negative effect
clpC	comX/sigX	negative effect
comR	comX/sigX	positive effect
comR	comS	positive effect
cipB	comR	positive effect
XrpA	comR	negative effect
clpP	comX/sigX	negative effect
XrpA	comX/sigX	negative effect
XrpA	comS	negative effect
scnK	comX/sigX	positive effect
comS	comX/sigX	positive effect
comS	comS	positive effect
oppD	comS	positive effect
cipB	comS	positive effect
comD/blpH	comX/sigX	positive effect
comD/blpH	comE/blpR	positive effect
vicR	comD/blpH	negative effect
comE/blpR	comD/blpH	positive effect
vicK	comD/blpH	negative effect
comC/blpC	comD/blpH	positive effect
vicK	comX/sigX	negative effect
vicK	comC/blpC	negative effect
vicK	comE/blpR	negative effect
comE/blpR	comX/sigX	positive effect
comE/blpR	comC/blpC	positive effect
comE/blpR	comA/nlmT	positive effect
comE/blpR	comE/blpR	positive effect
comE/blpR	comB/nlmE	positive effect
vicR	comE/blpR	negative effect
brsR	comX/sigX	positive effect
brsM	brsR	negative effect
cipB	comX/sigX	positive effect
vicR	comX/sigX	negative effect
vicR	comC/blpC	negative effect
comC/blpC	comX/sigX	positive effect
comA/nlmT	comC/blpC	positive effect
comB/nlmE	comC/blpC	positive effect
ciaH	comC/blpC	positive effect
sepM	comC/blpC	positive effect

Sequence

Protein

• Length: 62 a.a.
• Molecular weight: 7019.17 Da
• Isoelectric Point: 6.7077

>NTDB_id=371 1086868..1087053(-) (scnC) [Streptococcus mutans UA159]
MLGFNDVIVHFASPLNRLVSCHSLLNTFHYSETSLSQLTLFLNSFLIFALKPLDQKNDMLY*

Nucleotide

• Length: 186 bp

>NTDB_id=371 1086868..1087053(-) (scnC) [Streptococcus mutans UA159]
TTGCTTGGTTTCAATGATGTAATTGTTCATTTTGCTTCTCCTTTAAATCGTTTAGTGTCCTGTCATTCCCTTCTTAACAC
TTTTCATTATAGTGAGACTTCTTTATCTCAACTTACTCTCTTCCTTAATTCTTTCTTAATTTTTGCTTTGAAGCCCTTGG
ATCAGAAAAACGATATGTTATACTAA

Domains

No domain identified.

References

• [1]: Jeong Nam Kim et al. (2013) Core-gene-encoded peptide regulating virulence-associated traits in Streptococcus mutans. Journal of Bacteriology 195(12):2912-20. [PMID: 23603743]