Detailed information
Overview
| Name | brsR | Type | Regulator |
| Locus tag | SMU_RS09505 | Genome accession | NC_004350 |
| Coordinates | 1954077..1954511 (+) | Length | 144 a.a. |
| NCBI ID | WP_002262387.1 | Uniprot ID | Q8DRX6 |
| Organism | Streptococcus mutans UA159 | ||
| Function | antagonizing the proteolysis of ComX Competence regulation |
||
Function
The bacteriocin-specific transcription activator BrsR directly mediates this coordination by serving as an anti-adaptor protein responsible for antagonizing the proteolysis of the inherently unstable, natural competence-specific alternative sigma factor ComX. This BrsR ability functions entirely independent of its transcription regulator function and directly modulates the timing and severity of the natural competence phenotype.
Genomic Context
Location: 1949077..1959511
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS09485 (SMU.2075c) | - | 1951039..1952610 (-) | 1572 | WP_011074689.1 | membrane protein | - |
| SMU_RS09490 (SMU.2077c) | - | 1952844..1953143 (-) | 300 | WP_002262384.1 | DUF1292 domain-containing protein | - |
| SMU_RS09495 (SMU.2078c) | ruvX | 1953224..1953643 (-) | 420 | WP_002262385.1 | Holliday junction resolvase RuvX | - |
| SMU_RS09500 (SMU.2079c) | - | 1953640..1953909 (-) | 270 | WP_002262386.1 | IreB family regulatory phosphoprotein | - |
| SMU_RS09505 (SMU.2080) | brsR | 1954077..1954511 (+) | 435 | WP_002262387.1 | bacteriocin genes transcriptional regulator BrsR | Regulator |
| SMU_RS09510 (SMU.2081) | brsM | 1954524..1954970 (+) | 447 | WP_002262388.1 | bacteriocin genes regulator BrsM | Regulator |
| SMU_RS09515 | - | 1954961..1955173 (-) | 213 | WP_002262389.1 | hypothetical protein | - |
| SMU_RS09520 (SMU.2083c) | - | 1955300..1955725 (-) | 426 | WP_002262390.1 | hypothetical protein | - |
| SMU_RS09525 (SMU.2084c) | spx | 1955976..1956374 (-) | 399 | WP_002262391.1 | transcriptional regulator Spx | - |
| SMU_RS09530 (SMU.2085) | recA | 1956459..1957610 (-) | 1152 | WP_002262392.1 | recombinase RecA | Machinery gene |
| SMU_RS09535 (SMU.2086) | cinA | 1957650..1958906 (-) | 1257 | WP_002262393.1 | competence/damage-inducible protein A | Machinery gene |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| brsR | comX/sigX | positive effect |
| comX/sigX | late competence genes | positive effect |
| comX/sigX | late competence genes | positive effect |
| scnR | comX/sigX | positive effect |
| hdrR | comX/sigX | positive effect |
| hdrR | comR | positive effect |
| hdrM | hdrR | negative effect |
| mecA | comX/sigX | negative effect |
| clpC | comX/sigX | negative effect |
| comR | comX/sigX | positive effect |
| comR | comS | positive effect |
| cipB | comR | positive effect |
| XrpA | comR | negative effect |
| clpP | comX/sigX | negative effect |
| XrpA | comX/sigX | negative effect |
| XrpA | comS | negative effect |
| scnK | comX/sigX | positive effect |
| comS | comX/sigX | positive effect |
| comS | comS | positive effect |
| oppD | comS | positive effect |
| cipB | comS | positive effect |
| comD/blpH | comX/sigX | positive effect |
| comD/blpH | comE/blpR | positive effect |
| vicR | comD/blpH | negative effect |
| comE/blpR | comD/blpH | positive effect |
| vicK | comD/blpH | negative effect |
| comC/blpC | comD/blpH | positive effect |
| vicK | comX/sigX | negative effect |
| vicK | comC/blpC | negative effect |
| vicK | comE/blpR | negative effect |
| comE/blpR | comX/sigX | positive effect |
| comE/blpR | comC/blpC | positive effect |
| comE/blpR | comA/nlmT | positive effect |
| comE/blpR | comE/blpR | positive effect |
| comE/blpR | comB/nlmE | positive effect |
| vicR | comE/blpR | negative effect |
| scnC | comX/sigX | positive effect |
| brsM | brsR | negative effect |
| cipB | comX/sigX | positive effect |
| vicR | comX/sigX | negative effect |
| vicR | comC/blpC | negative effect |
| comC/blpC | comX/sigX | positive effect |
| comA/nlmT | comC/blpC | positive effect |
| comB/nlmE | comC/blpC | positive effect |
| ciaH | comC/blpC | positive effect |
| sepM | comC/blpC | positive effect |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 17187.24 Da Isoelectric Point: 10.5565
MKVKIIKDSNFKEPLLQIYTRHIDKQTQRVIDFIQQRPNIVYGYKNKCLEFIPLEKVIRIFTENKQVLIQTLTDTYLAKQ
RLYFFEQELGTPFIRISQGEIINIKYIKQLNLTIRGSIEVTFKNGTVSFVARRSLKRFKEQLNL
Nucleotide
Download Length: 435 bp
ATGAAAGTAAAAATTATCAAGGATTCAAACTTTAAGGAACCCTTACTCCAAATCTATACACGTCATATTGATAAACAAAC
GCAAAGAGTGATTGATTTTATTCAACAAAGACCTAATATCGTTTATGGTTACAAAAATAAATGCTTAGAGTTTATCCCAC
TAGAAAAAGTGATTCGTATTTTCACGGAAAACAAACAGGTCTTAATTCAAACACTAACCGATACCTATTTAGCTAAACAA
AGACTCTACTTTTTTGAGCAAGAATTAGGAACACCTTTTATTCGTATCTCCCAAGGTGAAATCATCAATATCAAATATAT
TAAACAATTGAATTTAACCATCCGAGGCAGCATTGAAGTGACTTTCAAAAATGGAACAGTCAGTTTCGTGGCTAGGCGAA
GTTTGAAACGCTTCAAAGAACAATTAAATCTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Hua Qin et al. (2021) The transcription regulator BrsR serves as a network hub of natural competence protein-protein interactions in Streptococcus mutans. Proceedings of The National Academy of Sciences of The United States of America 118(39):e2106048118. [PMID: 34544866] |
| [2] | Zhoujie Xie et al. (2010) Identification of a novel bacteriocin regulatory system in Streptococcus mutans. Molecular Microbiology 78(6):1431-47. [PMID: 21143316] |