Detailed information    

experimental Experimentally validated

Overview

Name   brsR   Type   Regulator
Locus tag   SMU_RS09505 Genome accession   NC_004350
Coordinates   1954077..1954511 (+) Length   144 a.a.
NCBI ID   WP_002262387.1    Uniprot ID   -
Organism   Streptococcus mutans UA159     
Function   antagonizing the proteolysis of ComX   
Competence regulation

Function

The bacteriocin-specific transcription activator BrsR directly mediates this coordination by serving as an anti-adaptor protein responsible for antagonizing the proteolysis of the inherently unstable, natural competence-specific alternative sigma factor ComX. This BrsR ability functions entirely independent of its transcription regulator function and directly modulates the timing and severity of the natural competence phenotype.


Genomic Context

Location: 1949077..1959511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMU_RS09485 (SMU.2075c) - 1951039..1952610 (-) 1572 WP_011074689.1 membrane protein -
  SMU_RS09490 (SMU.2077c) - 1952844..1953143 (-) 300 WP_002262384.1 DUF1292 domain-containing protein -
  SMU_RS09495 (SMU.2078c) ruvX 1953224..1953643 (-) 420 WP_002262385.1 Holliday junction resolvase RuvX -
  SMU_RS09500 (SMU.2079c) - 1953640..1953909 (-) 270 WP_002262386.1 IreB family regulatory phosphoprotein -
  SMU_RS09505 (SMU.2080) brsR 1954077..1954511 (+) 435 WP_002262387.1 bacteriocin genes transcriptional regulator BrsR Regulator
  SMU_RS09510 (SMU.2081) brsM 1954524..1954970 (+) 447 WP_002262388.1 bacteriocin genes regulator BrsM Regulator
  SMU_RS09515 - 1954961..1955173 (-) 213 WP_002262389.1 hypothetical protein -
  SMU_RS09520 (SMU.2083c) - 1955300..1955725 (-) 426 WP_002262390.1 hypothetical protein -
  SMU_RS09525 (SMU.2084c) spx 1955976..1956374 (-) 399 WP_002262391.1 transcriptional regulator Spx -
  SMU_RS09530 (SMU.2085) recA 1956459..1957610 (-) 1152 WP_002262392.1 recombinase RecA Machinery gene
  SMU_RS09535 (SMU.2086) cinA 1957650..1958906 (-) 1257 WP_002262393.1 competence/damage-inducible protein A Machinery gene

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  brsR comX/sigX positive effect
  comX/sigX late competence genes positive effect
  comX/sigX late competence genes positive effect
  scnR comX/sigX positive effect
  hdrR comX/sigX positive effect
  hdrR comR positive effect
  hdrM hdrR negative effect
  mecA comX/sigX negative effect
  clpC comX/sigX negative effect
  comR comX/sigX positive effect
  comR comS positive effect
  cipB comR positive effect
  XrpA comR negative effect
  clpP comX/sigX negative effect
  XrpA comX/sigX negative effect
  XrpA comS negative effect
  scnK comX/sigX positive effect
  comS comX/sigX positive effect
  comS comS positive effect
  oppD comS positive effect
  cipB comS positive effect
  comD/blpH comX/sigX positive effect
  comD/blpH comE/blpR positive effect
  vicR comD/blpH negative effect
  comE/blpR comD/blpH positive effect
  vicK comD/blpH negative effect
  comC/blpC comD/blpH positive effect
  vicK comX/sigX negative effect
  vicK comC/blpC negative effect
  vicK comE/blpR negative effect
  comE/blpR comX/sigX positive effect
  comE/blpR comC/blpC positive effect
  comE/blpR comA/nlmT positive effect
  comE/blpR comE/blpR positive effect
  comE/blpR comB/nlmE positive effect
  vicR comE/blpR negative effect
  scnC comX/sigX positive effect
  brsM brsR negative effect
  cipB comX/sigX positive effect
  vicR comX/sigX negative effect
  vicR comC/blpC negative effect
  comC/blpC comX/sigX positive effect
  comA/nlmT comC/blpC positive effect
  comB/nlmE comC/blpC positive effect
  ciaH comC/blpC positive effect
  sepM comC/blpC positive effect

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 17187.24 Da        Isoelectric Point: 10.5565

>NTDB_id=366 SMU_RS09505 WP_002262387.1 1954077..1954511(+) (brsR) [Streptococcus mutans UA159]
MKVKIIKDSNFKEPLLQIYTRHIDKQTQRVIDFIQQRPNIVYGYKNKCLEFIPLEKVIRIFTENKQVLIQTLTDTYLAKQ
RLYFFEQELGTPFIRISQGEIINIKYIKQLNLTIRGSIEVTFKNGTVSFVARRSLKRFKEQLNL

Nucleotide


Download         Length: 435 bp        

>NTDB_id=366 SMU_RS09505 WP_002262387.1 1954077..1954511(+) (brsR) [Streptococcus mutans UA159]
ATGAAAGTAAAAATTATCAAGGATTCAAACTTTAAGGAACCCTTACTCCAAATCTATACACGTCATATTGATAAACAAAC
GCAAAGAGTGATTGATTTTATTCAACAAAGACCTAATATCGTTTATGGTTACAAAAATAAATGCTTAGAGTTTATCCCAC
TAGAAAAAGTGATTCGTATTTTCACGGAAAACAAACAGGTCTTAATTCAAACACTAACCGATACCTATTTAGCTAAACAA
AGACTCTACTTTTTTGAGCAAGAATTAGGAACACCTTTTATTCGTATCTCCCAAGGTGAAATCATCAATATCAAATATAT
TAAACAATTGAATTTAACCATCCGAGGCAGCATTGAAGTGACTTTCAAAAATGGAACAGTCAGTTTCGTGGCTAGGCGAA
GTTTGAAACGCTTCAAAGAACAATTAAATCTTTAA

Domains

Predicted by InterproScan.

LytTr DNA-binding domain (LytTR)

(50-142)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Hua Qin et al. (2021) The transcription regulator BrsR serves as a network hub of natural competence protein-protein interactions in Streptococcus mutans. Proceedings of The National Academy of Sciences of The United States of America 118(39):e2106048118. [PMID: 34544866]
[2] Zhoujie Xie et al. (2010) Identification of a novel bacteriocin regulatory system in Streptococcus mutans. Molecular Microbiology 78(6):1431-47. [PMID: 21143316]