Detailed information of TA system TA000127

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/Xre-RelE
• Location: 3550374..3551044
• Replicon: chromosome
• Accession: NC_000962
• Organism: Mycobacterium tuberculosis H37Rv

Toxin (Protein)

• Gene name: higB
• Uniprot ID: O53332
• Locus tag: Rv3182
• Protein ID: 15610318
• Coordinates: 3550374..3550718 (+)
• Length: 115 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: O53333
• Locus tag: Rv3183
• Protein ID: 15610319
• Coordinates: 3550715..3551044 (+)
• Length: 110 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
Rv3177	3545447..3546307	+	861	NP_217693.1	peroxidase	-
Rv3178	3546438..3546797	+	360	NP_217694.1	nitroreductase	-
Rv3178a	3547037..3547330	+	294	YP_009030043.1	hypothetical protein	-
Rv3179	3547618..3548907	+	1290	NP_217695.1	hypothetical protein	-
Rv3180c	3549254..3549688	-	435	NP_217696.1	ribonuclease VapC45	-
Rv3181c	3549691..3550143	-	453	NP_217697.1	antitoxin VapB45	-
Rv3182	3550374..3550718	+	345	NP_217698.1	hypothetical protein	Toxin
Rv3183	3550715..3551044	+	330	NP_217699.1	transcriptional regulator	Antitoxin
Rv3188	3554298..3554645	+	348	NP_217704.1	hypothetical protein	-
Rv3189	3554642..3555262	+	621	NP_217705.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_018143 Mycobacterium tuberculosis H37Rv Prophage TA028112 3547615..3580492 0 View NZ_CP007027 Mycobacterium tuberculosis H37RvSiena Prophage TA045934 3549073..3576418 0.005 View NZ_CP009100 Mycobacterium tuberculosis strain ZMC13-264 Prophage TA048290 3549686..3580497 0.002 View NZ_CP009101 Mycobacterium tuberculosis strain ZMC13-88 Prophage TA048350 3547625..3580505 0.001 View NZ_CP012506 Mycobacterium tuberculosis strain SCAID 187.0 Prophage TA056594 3543681..3576287 0.002 View NZ_CP016794 Mycobacterium tuberculosis strain SCAID 320.0 Prophage TA065088 3544351..3576368 0.002 View NZ_CP016888 Mycobacterium tuberculosis strain SCAID 252.0 Prophage TA065389 3545264..3576041 0.003 View NZ_CP017920 Mycobacterium tuberculosis strain TB282 Prophage TA068342 4219814..4243935 0.009 View NZ_CP018778 Mycobacterium tuberculosis strain DK9897 Prophage TA070501 3549680..3580484 0.002 View NZ_CP023574 Mycobacterium tuberculosis strain CSV4644 Prophage TA081779 3547421..3576833 0.003 View NZ_CP023575 Mycobacterium tuberculosis strain CSV5769 Prophage TA081840 3549517..3580321 0.002 View NZ_CP023576 Mycobacterium tuberculosis strain CSV10399 Prophage TA081901 3547329..3576747 0.003 View NZ_CP023577 Mycobacterium tuberculosis strain CSV11678 Prophage TA081962 3549614..3580420 0.002 View NZ_CP023578 Mycobacterium tuberculosis strain LE486 Prophage TA082022 3549376..3576721 0.005 View NZ_CP023579 Mycobacterium tuberculosis strain LE492 Prophage TA082082 3549393..3576738 0.005 View NZ_CP023580 Mycobacterium tuberculosis strain LN180 Prophage TA082143 3549619..3580423 0.002 View NZ_CP023581 Mycobacterium tuberculosis strain LN2358 Prophage TA082204 3547487..3580364 0 View NZ_CP023582 Mycobacterium tuberculosis strain LN3756 Prophage TA082265 3547449..3580326 0 View NZ_CP023583 Mycobacterium tuberculosis strain MDRDM260 Prophage TA082326 3547414..3576832 0.003 View NZ_CP023584 Mycobacterium tuberculosis strain MDRDM627 Prophage TA082387 3549451..3576796 0.005 View NZ_CP023585 Mycobacterium tuberculosis strain MDRDM1098 Prophage TA082448 3549373..3576718 0.005 View NZ_CP023586 Mycobacterium tuberculosis strain MDRMA2491 Prophage TA082508 3549357..3576702 0.005 View NZ_CP023587 Mycobacterium tuberculosis strain ME1473 Prophage TA082568 3549423..3576768 0.005 View NZ_CP023588 Mycobacterium tuberculosis strain TBDM425 Prophage TA082629 3546475..3576693 0.004 View NZ_CP023589 Mycobacterium tuberculosis strain TBV5000 Prophage TA082690 3549475..3576821 0.005 View NZ_CP023590 Mycobacterium tuberculosis strain TBV5362 Prophage TA082751 3547425..3580303 0 View NZ_CP023591 Mycobacterium tuberculosis strain TBV5365 Prophage TA082812 3547506..3580384 0 View NZ_CP023593 Mycobacterium tuberculosis strain SLM040 Prophage TA082933 3547552..3580429 0 View NZ_CP023594 Mycobacterium tuberculosis strain SLM056 Prophage TA082994 3547514..3580391 0 View NZ_CP023595 Mycobacterium tuberculosis strain SLM060 Prophage TA083054 3547300..3576718 0.003 View NZ_CP023597 Mycobacterium tuberculosis strain SLM088 Prophage TA083176 3549625..3580429 0.002 View NZ_CP023598 Mycobacterium tuberculosis strain SLM100 Prophage TA083237 3549626..3580430 0.002 View NZ_CP023599 Mycobacterium tuberculosis strain CSV383 Prophage TA083297 3549366..3576711 0.005 View NZ_CP023601 Mycobacterium tuberculosis strain CSV9577 Prophage TA083419 3547441..3580318 0 View NZ_CP023602 Mycobacterium tuberculosis strain LE13 Prophage TA083480 3547516..3580393 0 View NZ_CP023603 Mycobacterium tuberculosis strain LE63 Prophage TA083541 3547525..3580402 0 View NZ_CP023604 Mycobacterium tuberculosis strain LE76 Prophage TA083602 3547337..3576755 0.003 View NZ_CP023605 Mycobacterium tuberculosis strain LE79 Prophage TA083663 3547564..3580441 0 View NZ_CP023606 Mycobacterium tuberculosis strain LE103 Prophage TA083724 3549524..3580328 0.002 View NZ_CP023607 Mycobacterium tuberculosis strain LE371 Prophage TA083785 3547347..3576765 0.003 View NZ_CP023608 Mycobacterium tuberculosis strain LE410 Prophage TA083846 3547515..3580392 0 View NZ_CP023609 Mycobacterium tuberculosis strain LN55 Prophage TA083906 3549436..3576781 0.005 View NZ_CP023610 Mycobacterium tuberculosis strain LN317 Prophage TA083967 3549550..3580354 0.002 View NZ_CP023611 Mycobacterium tuberculosis strain LN763 Prophage TA084028 3549479..3576825 0.005 View NZ_CP023613 Mycobacterium tuberculosis strain LN3584 Prophage TA084150 3547484..3580360 0 View NZ_CP023614 Mycobacterium tuberculosis strain LN3588 Prophage TA084211 3547475..3580346 0 View NZ_CP023615 Mycobacterium tuberculosis strain LN3589 Prophage TA084272 3547494..3580371 0 View NZ_CP023616 Mycobacterium tuberculosis strain LN3668 Prophage TA084333 3547586..3580463 0 View NZ_CP023617 Mycobacterium tuberculosis strain LN3672 Prophage TA084394 3549614..3580418 0.002 View NZ_CP023619 Mycobacterium tuberculosis strain LN1100 Prophage TA084516 3547555..3580432 0 View NZ_CP023620 Mycobacterium tuberculosis strain LN1856 Prophage TA084577 3549473..3576812 0.005 View NZ_CP023621 Mycobacterium tuberculosis strain LN2900 Prophage TA084638 3547412..3576824 0.003 View NZ_CP023622 Mycobacterium tuberculosis strain MDRDM827 Prophage TA084699 3547400..3576819 0.003 View NZ_CP023625 Mycobacterium tuberculosis strain MDRMA863 Prophage TA084881 3547559..3580436 0 View NZ_CP023626 Mycobacterium tuberculosis strain MDRMA1565 Prophage TA084941 3549400..3576745 0.005 View NZ_CP023627 Mycobacterium tuberculosis strain MDRMA2019 Prophage TA085001 3547339..3576757 0.003 View NZ_CP023628 Mycobacterium tuberculosis strain MDRMA2082 Prophage TA085062 3547567..3580444 0 View NZ_CP023629 Mycobacterium tuberculosis strain MDRMA2260 Prophage TA085123 3549519..3580323 0.002 View NZ_CP023630 Mycobacterium tuberculosis strain MDRMA2441 Prophage TA085184 3547520..3580397 0 View NZ_CP023631 Mycobacterium tuberculosis strain TBDM1506 Prophage TA085244 3549468..3576813 0.005 View NZ_CP023632 Mycobacterium tuberculosis strain TBDM2189 Prophage TA085305 3547437..3580314 0 View NZ_CP023633 Mycobacterium tuberculosis strain TBDM2444 Prophage TA085366 3547405..3576823 0.003 View NZ_CP023634 Mycobacterium tuberculosis strain TBDM2487 Prophage TA085427 3547459..3580336 0 View NZ_CP023635 Mycobacterium tuberculosis strain TBDM2489 Prophage TA085488 3549525..3580330 0.002 View NZ_CP023636 Mycobacterium tuberculosis strain TBDM2699 Prophage TA085549 3547572..3580449 0 View NZ_CP023637 Mycobacterium tuberculosis strain TBDM2717 Prophage TA085610 3547558..3580435 0 View NZ_CP023638 Mycobacterium tuberculosis strain TBV4766 Prophage TA085671 3547396..3576808 0.003 View NZ_CP023639 Mycobacterium tuberculosis strain TBV4768 Prophage TA085731 3547327..3576746 0.003 View NZ_CP023640 Mycobacterium tuberculosis strain TBV4952 Prophage TA085792 3547551..3580428 0 View NZ_CP025593 Mycobacterium tuberculosis strain GG-111-10 Prophage TA090684 3549703..3580507 0.002 View NZ_CP025594 Mycobacterium tuberculosis strain GG-5-10 Prophage TA090745 3547556..3580433 0 View NZ_CP025595 Mycobacterium tuberculosis strain GG-20-11 Prophage TA090806 3547607..3580484 0 View NZ_CP025596 Mycobacterium tuberculosis strain GG-27-11 Prophage TA090867 3547516..3580393 0 View NZ_CP025597 Mycobacterium tuberculosis strain GG-36-11 Prophage TA090927 3547575..3580452 0 View NZ_CP025598 Mycobacterium tuberculosis strain GG-37-11 Prophage TA090988 3549698..3580502 0.002 View NZ_CP025599 Mycobacterium tuberculosis strain GG-45-11 Prophage TA091049 3547575..3580452 0 View NZ_CP025600 Mycobacterium tuberculosis strain GG-77-11 Prophage TA091110 3549674..3580477 0.002 View NZ_CP025601 Mycobacterium tuberculosis strain GG-90-10 Prophage TA091171 3547652..3580525 0 View NZ_CP025602 Mycobacterium tuberculosis strain GG-109-10 Prophage TA091232 3549656..3580460 0.002 View NZ_CP025603 Mycobacterium tuberculosis strain GG-121-10 Prophage TA091293 3549672..3580476 0.002 View NZ_CP025604 Mycobacterium tuberculosis strain GG-129-11 Prophage TA091354 3547507..3580384 0 View NZ_CP025605 Mycobacterium tuberculosis strain GG-134-11 Prophage TA091415 3547574..3580451 0 View NZ_CP025606 Mycobacterium tuberculosis strain GG-137-10 Prophage TA091476 3549660..3580464 0.002 View NZ_CP025607 Mycobacterium tuberculosis strain GG-186-10 Prophage TA091537 3549684..3580488 0.002 View NZ_CP025608 Mycobacterium tuberculosis strain GG-229-10 Prophage TA091598 3547606..3580483 0 View NZ_CP041846 Mycobacterium tuberculosis strain 1-0153P6C4 Prophage TA132815 3541462..3574478 0.002 View NZ_CP041854 Mycobacterium tuberculosis strain 1-0102P6C4 Prophage TA133293 3546423..3580880 0 View NZ_CP041855 Mycobacterium tuberculosis strain 1-0084P6C4 Prophage TA133353 3544436..3576025 0.005 View NZ_CP041858 Mycobacterium tuberculosis strain 1-0064P6C4 Prophage TA133533 3542793..3575820 0.001 View NZ_CP041861 Mycobacterium tuberculosis strain 1-0054P6C4 Prophage TA133713 3543018..3575965 0.005 View NZ_CP041867 Mycobacterium tuberculosis strain 1-0031P6C4 Prophage TA134070 3545073..3576071 0.003 View NZ_CP046728 Mycobacterium tuberculosis strain TCDC11 Prophage TA144816 3542011..3576397 0.001 View NZ_CP054014 Mycobacterium tuberculosis strain FDAARGOS_756 Prophage TA158511 4077036..4101157 0.009 View NZ_CP058236 Mycobacterium tuberculosis strain 060827 Prophage TA166374 3574774..3599832 0.009 View NZ_CP069067 Mycobacterium tuberculosis strain N1268 Prophage TA189211 3563024..3596720 0.002 View NZ_CP071127 Mycobacterium tuberculosis strain 120/26CAO Prophage TA195384 3549683..3577028 0.005 View NZ_CP071128 Mycobacterium tuberculosis strain 267/47W148 Prophage TA195445 3547614..3580491 0 View NZ_CP089780 Mycobacterium tuberculosis strain M0003941-3 Prophage TA229199 3544003..3569149 0.008 View NZ_LR882499 Mycobacterium tuberculosis variant microti OV254 isolate vole Prophage TA289895 3539938..3571633 0.002	inside	Prophage	-	-	3547618..3580495	32877

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-103)

Antitoxin

• Cro/C1-type helix-turn-helix domain (38-91)

Sequences

Toxin

Protein

• Length: 115 a.a.
• Molecular weight: 12692.50 Da
• Isoelectric Point: 5.6920

>T127 15610318 NC_000962:3550374-3550718 [Mycobacterium tuberculosis H37Rv]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG

Nucleotide

• Length: 345 bp

>T127 NC_000962:3550374-3550718 [Mycobacterium tuberculosis H37Rv]
TTGGCCGTGATCCTGCTCCCGCAGGTCGAACGGTGGTTCTTCGCGCTCAACAGGGATGCGATGGCCTCGGTCACCGGCGC
CATCGACCTGCTCGAAATGGAGGGGCCGACGTTGGGCCGCCCGGTGGTCGACAAAGTGAACGACTCAACGTTTCACAACA
TGAAGGAGCTGCGCCCCGCCGGCACCAGCATCCGGATCCTGTTCGCCTTCGACCCGGCCCGGCAGGCGATCCTGCTGCTG
GGCGGTGACAAGGCAGGCAACTGGAAACGCTGGTACGACAACAACATTCCAATCGCTGACCAGCGCTCCGAGAACTGGCT
GGCGAGCGAGCACGGAGGTGGATGA

Antitoxin

Protein

• Length: 110 a.a.
• Molecular weight: 11802.46 Da
• Isoelectric Point: 7.4051

>AT127 15610319 NC_000962:3550715-3551044 [Mycobacterium tuberculosis H37Rv]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA

Nucleotide

• Length: 330 bp

>AT127 NC_000962:3550715-3551044 [Mycobacterium tuberculosis H37Rv]
ATGACCATGGCCCGCAACTGGCGTGACATTCGCGCCGATGCCGTCGCGCAGGGCCGCGTGGATCTGCAGCGGGCCGCCGT
GGCACGCGAGGAGATGCGCGATGCCGTCCTGGCGCACCGCCTGGCCGAGATCCGCAAGGCGCTAGGCCACGCACGTCAGG
CCGACGTCGCGGCGCTGATGGGGGTCTCTCAGGCCCGTGTCTCCAAGCTGGAGAGCGGCGACCTGTCCCACACCGAACTC
GGCACCCTGCAGGCCTACGTTGCCGCCCTGGGCGGGCACCTGCGCATCGTCGCTGAGTTCGGCGAAAATACTGTCGAGCT
GACCGCCTGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10050	Mycobacterium tuberculosis H37Rv	50.505	86.842	0.439
T10169	Acinetobacter baumannii	44.545	96.491	0.43

Multiple sequence alignment

Antitoxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT10050	Mycobacterium tuberculosis H37Rv	42.991	100	0.455

Multiple sequence alignment

Structures

Toxin

• AlphaFold DB: O53332

Antitoxin

• PDB: 6LTY
• PDB: 6LTZ
• AlphaFold DB: O53333

References

(1) Jin-Young Park et al. (2020) Induced DNA bending by unique dimerization of HigA antitoxin. IUCrJ 7(Pt 4):748-760. [PubMed:32695421]


 protein structure literature