Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3544052..3544722 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | JN986_RS16525 | Protein ID | WP_003899954.1 |
| Coordinates | 3544052..3544396 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | JN986_RS16530 | Protein ID | WP_003899955.1 |
| Coordinates | 3544393..3544722 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS16500 | 3539357..3539650 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| JN986_RS16510 | 3541392..3542585 | + | 1194 | Protein_3259 | ATP-binding protein | - |
| JN986_RS16515 | 3542932..3543366 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN986_RS16520 | 3543369..3543821 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JN986_RS16525 | 3544052..3544396 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JN986_RS16530 | 3544393..3544722 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| JN986_RS16535 | 3545084..3546345 | + | 1262 | WP_105799563.1 | IS3-like element IS987 family transposase | - |
| JN986_RS16540 | 3546550..3547815 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
| JN986_RS16545 | 3547983..3548192 | + | 210 | WP_003416778.1 | hypothetical protein | - |
| JN986_RS16550 | 3548439..3549473 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3539938..3571633 | 31695 | ||
| - | inside | IScluster/Tn | - | - | 3540079..3546345 | 6266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T289895 WP_003899954.1 NZ_LR882499:3544052-3544396 [Mycobacterium tuberculosis variant microti OV254]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT289895 WP_003899955.1 NZ_LR882499:3544393-3544722 [Mycobacterium tuberculosis variant microti OV254]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |