Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 2665201..2665403 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA03825 | ||
Toxin (Protein)
| Gene name | CD2299.1 | Uniprot ID | Q185H1 |
| Locus tag | CD630_RS19805 | Protein ID | WP_004454589.1 |
| Coordinates | 2665251..2665403 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ1641 | ||
| Locus tag | - | ||
| Coordinates | 2665201..2665330 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS12395 (CD630_22950) | 2660635..2661099 | + | 465 | WP_011861514.1 | hypothetical protein | - |
| CD630_RS19795 (CD630_22952) | 2661427..2661588 | - | 162 | WP_004454578.1 | hypothetical protein | - |
| CD630_RS12400 | 2661640..2662453 | - | 814 | Protein_2396 | toxin Bro | - |
| CD630_RS19800 | 2662573..2662725 | - | 153 | WP_021361915.1 | hypothetical protein | - |
| CD630_RS12405 (CD630_22990) | 2664134..2665057 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
| - | 2665201..2665330 | + | 130 | - | - | Antitoxin |
| CD630_RS19805 (CD630_22991) | 2665251..2665403 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
| CD630_RS12410 (CD630_23000) | 2665677..2666000 | - | 324 | WP_009897482.1 | hypothetical protein | - |
| CD630_RS12415 (CD630_23010) | 2666036..2666290 | - | 255 | WP_004454592.1 | hypothetical protein | - |
| CD630_RS12420 (CD630_23020) | 2666726..2667244 | - | 519 | Protein_2402 | transposase | - |
| CD630_RS12425 | 2667534..2667909 | - | 376 | Protein_2403 | BlaI/MecI/CopY family transcriptional regulator | - |
| CD630_RS12430 (CD630_23040) | 2668014..2668391 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| CD630_RS12435 (CD630_23050) | 2669195..2669689 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| CD630_RS12440 (CD630_23052) | 2670078..2670248 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2658361..2675497 | 17136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T10176 WP_004454589.1 NC_009089:c2665403-2665251 [Clostridioides difficile 630]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T10176 NC_009089:c2665403-2665251 [Clostridioides difficile 630]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT10176 NC_009089:2665201-2665330 [Clostridioides difficile 630]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10175 | Clostridium difficile 630 |
68 |
100 |
0.68 |
| T10174 | Clostridium difficile 630 |
58 |
100 |
0.58 |
| T10172 | Clostridium difficile 630 |
50.943 |
100 |
0.54 |
| T10173 | Clostridium difficile 630 |
50.943 |
100 |
0.54 |
| T10081 | Clostridium difficile 630 |
50 |
100 |
0.532 |
| T10080 | Clostridium difficile 630 |
50 |
100 |
0.532 |
| T10083 | Clostridium difficile 630 |
40 |
100 |
0.471 |
| T10084 | Clostridium difficile 630 |
40 |
100 |
0.471 |
| T10171 | Clostridium difficile 630 |
44.231 |
100 |
0.46 |
| T10082 | Clostridium difficile 630 |
36.842 |
100 |
0.4 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Anna Maikova et al. (2018) Discovery of new type I toxin-antitoxin systems adjacent to CRISPR arrays in Clostridium difficile. Nucleic Acids Research 46(9):4733-4751. [PubMed:29529286]