Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1142224..1142439 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA07130 | ||
Toxin (Protein)
| Gene name | CD0977.1 | Uniprot ID | Q18AH6 |
| Locus tag | CD630_RS19700 | Protein ID | WP_011861054.1 |
| Coordinates | 1142224..1142367 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | RCd11 | ||
| Locus tag | - | ||
| Coordinates | 1142289..1142439 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS05445 (CD630_09690) | 1137411..1137593 | + | 183 | WP_011861045.1 | hypothetical protein | - |
| CD630_RS05450 (CD630_09700) | 1137628..1137858 | + | 231 | WP_011861046.1 | hemolysin XhlA family protein | - |
| CD630_RS05455 (CD630_09710) | 1137878..1138138 | + | 261 | WP_011861047.1 | phage holin family protein | - |
| CD630_RS05460 (CD630_09720) | 1138135..1138950 | + | 816 | WP_011861048.1 | N-acetylmuramoyl-L-alanine amidase | - |
| CD630_RS05465 (CD630_09730) | 1138967..1139263 | + | 297 | WP_011861049.1 | hypothetical protein | - |
| CD630_RS05470 (CD630_09750) | 1139809..1140372 | + | 564 | WP_021371073.1 | hypothetical protein | - |
| CD630_RS05475 (CD630_09760) | 1140390..1140821 | + | 432 | WP_011861052.1 | protein-export chaperone SecB | - |
| CD630_RS05480 (CD630_09770) | 1140823..1141527 | + | 705 | WP_011861053.1 | hypothetical protein | - |
| CD630_RS05485 (CD630_09772) | 1141775..1141963 | - | 189 | WP_009898401.1 | hypothetical protein | - |
| CD630_RS19700 (CD630_09771) | 1142224..1142367 | + | 144 | WP_011861054.1 | hypothetical protein | Toxin |
| - | 1142289..1142439 | - | 151 | - | - | Antitoxin |
| CD630_RS05490 (CD630_09780) | 1142981..1143262 | + | 282 | WP_009898394.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| CD630_RS05495 (CD630_09790) | 1143302..1143688 | + | 387 | WP_011861055.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| CD630_RS05500 | 1143874..1144398 | + | 525 | Protein_1009 | 4Fe-4S dicluster domain-containing protein | - |
| CD630_RS05505 (CD630_09810) | 1144782..1146020 | + | 1239 | WP_011861056.1 | hypothetical protein | - |
| CD630_RS05510 (CD630_09820) | 1146049..1146936 | + | 888 | WP_011861057.1 | decaprenyl-phosphate phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1078053..1143688 | 65635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5337.27 Da Isoelectric Point: 10.5719
>T10080 WP_011861054.1 NC_009089:1142224-1142367 [Clostridioides difficile 630]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
Download Length: 144 bp
>T10080 NC_009089:1142224-1142367 [Clostridioides difficile 630]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
Antitoxin
Download Length: 151 bp
>AT10080 NC_009089:c1142439-1142289 [Clostridioides difficile 630]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10081 | Clostridium difficile 630 |
95.745 |
100 |
0.957 |
| T10174 | Clostridium difficile 630 |
60 |
100 |
0.638 |
| T10176 | Clostridium difficile 630 |
50 |
100 |
0.532 |
| T10172 | Clostridium difficile 630 |
47.059 |
100 |
0.511 |
| T10173 | Clostridium difficile 630 |
47.059 |
100 |
0.511 |
| T10171 | Clostridium difficile 630 |
46 |
100 |
0.489 |
| T10175 | Clostridium difficile 630 |
46 |
100 |
0.489 |
| T10083 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
| T10084 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Johann Peltier et al. (2020) Type I toxin-antitoxin systems contribute to the maintenance of mobile genetic elements in Clostridioides difficile. Communications Biology 3(1):718. [PubMed:33247281]