Detailed information of TA system TA285467

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): CD-RCd/-
• Location: 1147503..1147718
• Replicon: chromosome
• Accession: NZ_LN614756
• Organism: Clostridioides difficile strain 630Derm

Toxin (Protein)

• Gene name: CD0977.1
• Uniprot ID: Q18AH6
• Locus tag: CD630DERM_RS20895
• Protein ID: WP_011861054.1
• Coordinates: 1147503..1147646 (+)
• Length: 48 a.a.

Antitoxin (RNA)

Gene name	RCd11
Locus tag	-
Coordinates	1147568..1147718 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CD630DERM_RS05560	1142690..1142872	+	183	WP_011861045.1	hypothetical protein	-
CD630DERM_RS05565	1142907..1143137	+	231	WP_011861046.1	hemolysin XhlA family protein	-
CD630DERM_RS05570	1143157..1143417	+	261	WP_011861047.1	phage holin family protein	-
CD630DERM_RS05575	1143414..1144229	+	816	WP_011861048.1	N-acetylmuramoyl-L-alanine amidase	-
CD630DERM_RS05580	1144246..1144542	+	297	WP_011861049.1	hypothetical protein	-
CD630DERM_RS05585	1145088..1145651	+	564	WP_021371073.1	hypothetical protein	-
CD630DERM_RS05590	1145669..1146100	+	432	WP_011861052.1	protein-export chaperone SecB	-
CD630DERM_RS05595	1146102..1146806	+	705	WP_011861053.1	hypothetical protein	-
CD630DERM_RS05600	1147054..1147242	-	189	WP_009898401.1	hypothetical protein	-
CD630DERM_RS20895	1147503..1147646	+	144	WP_011861054.1	hypothetical protein	Toxin
-	1147568..1147718	-	151	NuclAT_0	-	Antitoxin
-	1147572..1147718	-	147	NuclAT_3	-	-
CD630DERM_RS05610	1148260..1148541	+	282	WP_009898394.1	BlaI/MecI/CopY family transcriptional regulator	-
CD630DERM_RS05615	1148581..1148967	+	387	WP_011861055.1	BlaI/MecI/CopY family transcriptional regulator	-
CD630DERM_RS05620	1149153..1149677	+	525	Protein_1009	4Fe-4S dicluster domain-containing protein	-
CD630DERM_RS05625	1150061..1151299	+	1239	WP_011861056.1	hypothetical protein	-
CD630DERM_RS05630	1151328..1152215	+	888	WP_011861057.1	decaprenyl-phosphate phosphoribosyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_009089 Clostridium difficile 630 Prophage TA010080, TA010082, TA010083, TA010173 1078053..1143688 0.003	inside	Prophage	-	-	1076912..1148967	72055

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 48 a.a.
• Molecular weight: 5337.27 Da
• Isoelectric Point: 10.5719

>T285467 WP_011861054.1 NZ_LN614756:1147503-1147646 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH

Nucleotide

• Length: 144 bp

Antitoxin

Nucleotide

• Length: 151 bp

>AT285467 NZ_LN614756:c1147718-1147568 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG

Structures

Toxin

• AlphaFold DB: Q18AH6

Antitoxin