Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1124627..1124789 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA07133 | ||
Toxin (Protein)
| Gene name | CD0956.3 | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 1124627..1124731 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | RCd14 | ||
| Locus tag | - | ||
| Coordinates | 1124684..1124789 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS05345 (CD630_09500) | 1119707..1120108 | + | 402 | WP_009888836.1 | hypothetical protein | - |
| CD630_RS05350 (CD630_09510) | 1120102..1120449 | + | 348 | WP_003429844.1 | hypothetical protein | - |
| CD630_RS05355 (CD630_09520) | 1120449..1120874 | + | 426 | WP_011861030.1 | HK97 gp10 family phage protein | - |
| CD630_RS05360 (CD630_09530) | 1120867..1121304 | + | 438 | WP_009901504.1 | hypothetical protein | - |
| CD630_RS19690 (CD630_09531) | 1121297..1121473 | + | 177 | WP_011861031.1 | hypothetical protein | - |
| CD630_RS05365 (CD630_09540) | 1121475..1122785 | + | 1311 | WP_011861032.1 | phage tail sheath family protein | - |
| CD630_RS05370 (CD630_09550) | 1122802..1123272 | + | 471 | WP_003429851.1 | phage tail tube protein | - |
| CD630_RS05375 (CD630_09560) | 1123344..1123784 | + | 441 | WP_003429853.1 | phage portal protein | - |
| CD630_RS19695 (CD630_09562) | 1124125..1124286 | + | 162 | WP_003429855.1 | hypothetical protein | - |
| - | 1124627..1124731 | + | 105 | - | - | Toxin |
| - | 1124684..1124789 | - | 106 | - | - | Antitoxin |
| CD630_RS05385 (CD630_09570) | 1125950..1126510 | + | 561 | WP_011861034.1 | lipoprotein | - |
| CD630_RS05390 (CD630_09580) | 1126554..1127123 | + | 570 | WP_011861035.1 | zinc-ribbon domain-containing protein | - |
| CD630_RS05395 (CD630_09590) | 1127194..1129545 | + | 2352 | WP_011861036.1 | tape measure protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1078053..1143688 | 65635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3747.45 Da Isoelectric Point: 9.7388
>T10083 - NC_009089:1124627-1124731 [Clostridioides difficile 630]
MIGFLLSILAGVISAYIYDKIKNHPDANKGDLKK
MIGFLLSILAGVISAYIYDKIKNHPDANKGDLKK
Download Length: 105 bp
>T10083 NC_009089:1124627-1124731 [Clostridioides difficile 630]
ATGATAGGTTTTTTATTAAGCATACTAGCTGGTGTTATATCAGCTTATATTTATGACAAAATAAAAAATCACCCAGACGC
CAATAAGGGTGATTTAAAAAAATAA
ATGATAGGTTTTTTATTAAGCATACTAGCTGGTGTTATATCAGCTTATATTTATGACAAAATAAAAAATCACCCAGACGC
CAATAAGGGTGATTTAAAAAAATAA
Antitoxin
Download Length: 106 bp
>AT10083 NC_009089:c1124789-1124684 [Clostridioides difficile 630]
AAGGAAATAATTTACTTTATACAAGAGTAGCTATTTCCATCAAAATTGATTTAAAGAATTATTTTTTTAAATCACCCTTA
TTGGCGTCTGGGTGATTTTTTATTTT
AAGGAAATAATTTACTTTATACAAGAGTAGCTATTTCCATCAAAATTGATTTAAAGAATTATTTTTTTAAATCACCCTTA
TTGGCGTCTGGGTGATTTTTTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10084 | Clostridium difficile 630 |
100 |
100 |
1 |
| T10082 | Clostridium difficile 630 |
79.412 |
100 |
0.794 |
| T10176 | Clostridium difficile 630 |
40 |
100 |
0.471 |
| T10172 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10173 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10081 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
| T10080 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Johann Peltier et al. (2020) Type I toxin-antitoxin systems contribute to the maintenance of mobile genetic elements in Clostridioides difficile. Communications Biology 3(1):718. [PubMed:33247281]