Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 3397852..3398014 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA07134 | ||
Toxin (Protein)
| Gene name | CD2907.2 | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 3397910..3398014 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | RCd15 | ||
| Locus tag | - | ||
| Coordinates | 3397852..3397957 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS15510 (CD630_29050) | 3393096..3395447 | - | 2352 | WP_011861036.1 | tape measure protein | - |
| CD630_RS15515 (CD630_29060) | 3395518..3396087 | - | 570 | WP_011861035.1 | zinc-ribbon domain-containing protein | - |
| CD630_RS15520 (CD630_29070) | 3396131..3396691 | - | 561 | WP_011861034.1 | lipoprotein | - |
| - | 3397852..3397957 | + | 106 | - | - | Antitoxin |
| - | 3397910..3398014 | - | 105 | - | - | Toxin |
| CD630_RS19840 (CD630_29071) | 3398355..3398516 | - | 162 | WP_003429855.1 | hypothetical protein | - |
| CD630_RS15530 (CD630_29080) | 3398857..3399297 | - | 441 | WP_003429853.1 | phage portal protein | - |
| CD630_RS15535 (CD630_29090) | 3399369..3399839 | - | 471 | WP_003429851.1 | phage tail tube protein | - |
| CD630_RS15540 (CD630_29100) | 3399856..3401166 | - | 1311 | WP_011861032.1 | phage tail sheath family protein | - |
| CD630_RS19845 (CD630_29101) | 3401168..3401344 | - | 177 | WP_011861031.1 | hypothetical protein | - |
| CD630_RS15545 (CD630_29110) | 3401337..3401774 | - | 438 | WP_009901504.1 | hypothetical protein | - |
| CD630_RS15550 (CD630_29120) | 3401767..3402192 | - | 426 | WP_011861030.1 | HK97 gp10 family phage protein | - |
| CD630_RS15555 (CD630_29130) | 3402192..3402539 | - | 348 | WP_003429844.1 | hypothetical protein | - |
| CD630_RS15560 (CD630_29140) | 3402533..3402934 | - | 402 | WP_009888836.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3375898..3428859 | 52961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3747.45 Da Isoelectric Point: 9.7388
>T10084 - NC_009089:c3398014-3397910 [Clostridioides difficile 630]
MIGFLLSILAGVISAYIYDKIKNHPDANKGDLKK
MIGFLLSILAGVISAYIYDKIKNHPDANKGDLKK
Download Length: 105 bp
>T10084 NC_009089:c3398014-3397910 [Clostridioides difficile 630]
ATGATAGGTTTTTTATTAAGCATACTAGCTGGTGTTATATCAGCTTATATTTATGACAAAATAAAAAATCACCCAGACGC
CAATAAGGGTGATTTAAAAAAATAA
ATGATAGGTTTTTTATTAAGCATACTAGCTGGTGTTATATCAGCTTATATTTATGACAAAATAAAAAATCACCCAGACGC
CAATAAGGGTGATTTAAAAAAATAA
Antitoxin
Download Length: 106 bp
>AT10084 NC_009089:3397852-3397957 [Clostridioides difficile 630]
AAGGAAATAATTTACTTTATACAAGAGTAGCTATTTCCATCAAAATTGATTTAAAGAATTATTTTTTTAAATCACCCTTA
TTGGCGTCTGGGTGATTTTTTATTTT
AAGGAAATAATTTACTTTATACAAGAGTAGCTATTTCCATCAAAATTGATTTAAAGAATTATTTTTTTAAATCACCCTTA
TTGGCGTCTGGGTGATTTTTTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10083 | Clostridium difficile 630 |
100 |
100 |
1 |
| T10082 | Clostridium difficile 630 |
79.412 |
100 |
0.794 |
| T10176 | Clostridium difficile 630 |
40 |
100 |
0.471 |
| T10172 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10173 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10081 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
| T10080 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Johann Peltier et al. (2020) Type I toxin-antitoxin systems contribute to the maintenance of mobile genetic elements in Clostridioides difficile. Communications Biology 3(1):718. [PubMed:33247281]