Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 3355523..3355737 | Replicon | chromosome |
| Accession | NZ_LN614756 | ||
| Organism | Clostridioides difficile strain 630Derm | ||
Toxin (Protein)
| Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
| Locus tag | CD630DERM_RS21035 | Protein ID | WP_003429855.1 |
| Coordinates | 3355576..3355737 (-) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | RCd10 | ||
| Locus tag | - | ||
| Coordinates | 3355523..3355656 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630DERM_RS20325 | 3352739..3353308 | - | 570 | WP_011861035.1 | zinc-ribbon domain-containing protein | - |
| CD630DERM_RS15600 | 3353352..3353912 | - | 561 | WP_011861034.1 | lipoprotein | - |
| - | 3355073..3355178 | + | 106 | NuclAT_12 | - | - |
| - | 3355073..3355178 | + | 106 | NuclAT_14 | - | - |
| - | 3355523..3355656 | + | 134 | NuclAT_6 | - | Antitoxin |
| - | 3355523..3355656 | + | 134 | NuclAT_8 | - | Antitoxin |
| CD630DERM_RS21035 | 3355576..3355737 | - | 162 | WP_003429855.1 | hypothetical protein | Toxin |
| CD630DERM_RS15610 | 3356078..3356518 | - | 441 | WP_003429853.1 | phage portal protein | - |
| CD630DERM_RS15615 | 3356590..3357060 | - | 471 | WP_003429851.1 | phage tail tube protein | - |
| CD630DERM_RS15620 | 3357077..3358387 | - | 1311 | WP_011861032.1 | phage tail sheath family protein | - |
| CD630DERM_RS21040 | 3358389..3358565 | - | 177 | WP_011861031.1 | hypothetical protein | - |
| CD630DERM_RS15630 | 3358558..3358995 | - | 438 | WP_009901504.1 | hypothetical protein | - |
| CD630DERM_RS15635 | 3358988..3359413 | - | 426 | WP_011861030.1 | HK97 gp10 family phage protein | - |
| CD630DERM_RS15640 | 3359413..3359760 | - | 348 | WP_003429844.1 | hypothetical protein | - |
| CD630DERM_RS15645 | 3359754..3360155 | - | 402 | WP_009888836.1 | hypothetical protein | - |
| CD630DERM_RS15650 | 3360165..3360398 | - | 234 | WP_009896624.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3337900..3386080 | 48180 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T285478 WP_003429855.1 NZ_LN614756:c3355737-3355576 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 134 bp
>AT285478 NZ_LN614756:3355523-3355656 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|