Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 3380206..3380421 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA07131 | ||
Toxin (Protein)
| Gene name | CD2889 | Uniprot ID | Q183X5 |
| Locus tag | CD630_RS19835 | Protein ID | WP_011861731.1 |
| Coordinates | 3380278..3380421 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | RCd12 | ||
| Locus tag | - | ||
| Coordinates | 3380206..3380352 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS15405 (CD630_28870) | 3375865..3377019 | + | 1155 | WP_003439713.1 | GGDEF domain-containing protein | - |
| CD630_RS15410 (CD630_28880) | 3377100..3378818 | - | 1719 | WP_011861730.1 | putative 2-aminoethylphosphonate ABC transporter permease subunit | - |
| CD630_RS15415 | 3378823..3379704 | - | 882 | Protein_2998 | ATP-binding cassette domain-containing protein | - |
| - | 3380206..3380352 | + | 147 | - | - | Antitoxin |
| CD630_RS19835 (CD630_28890) | 3380278..3380421 | - | 144 | WP_011861731.1 | hypothetical protein | Toxin |
| CD630_RS15420 | 3380679..3380867 | + | 189 | WP_009898401.1 | hypothetical protein | - |
| CD630_RS15425 (CD630_28900) | 3381114..3381818 | - | 705 | WP_011861732.1 | hypothetical protein | - |
| CD630_RS15430 (CD630_28910) | 3381820..3382251 | - | 432 | WP_011861052.1 | protein-export chaperone SecB | - |
| CD630_RS15435 (CD630_28920) | 3382269..3382832 | - | 564 | WP_021371073.1 | hypothetical protein | - |
| CD630_RS15440 (CD630_28930) | 3383378..3383674 | - | 297 | WP_011861049.1 | hypothetical protein | - |
| CD630_RS15445 (CD630_28940) | 3383691..3384506 | - | 816 | WP_011861048.1 | N-acetylmuramoyl-L-alanine amidase | - |
| CD630_RS15450 (CD630_28941) | 3384503..3384763 | - | 261 | WP_011861047.1 | phage holin family protein | - |
| CD630_RS15455 (CD630_28950) | 3384783..3385013 | - | 231 | WP_011861046.1 | hemolysin XhlA family protein | - |
| CD630_RS15460 | 3385048..3385230 | - | 183 | WP_011861045.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3375898..3428859 | 52961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T10081 WP_011861731.1 NC_009089:c3380421-3380278 [Clostridioides difficile 630]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T10081 NC_009089:c3380421-3380278 [Clostridioides difficile 630]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 147 bp
>AT10081 NC_009089:3380206-3380352 [Clostridioides difficile 630]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10080 | Clostridium difficile 630 |
95.745 |
100 |
0.957 |
| T10174 | Clostridium difficile 630 |
62 |
100 |
0.66 |
| T10172 | Clostridium difficile 630 |
49.02 |
100 |
0.532 |
| T10173 | Clostridium difficile 630 |
49.02 |
100 |
0.532 |
| T10176 | Clostridium difficile 630 |
50 |
100 |
0.532 |
| T10175 | Clostridium difficile 630 |
48 |
100 |
0.511 |
| T10171 | Clostridium difficile 630 |
42.308 |
100 |
0.468 |
| T10083 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
| T10084 | Clostridium difficile 630 |
30.556 |
100 |
0.324 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Johann Peltier et al. (2020) Type I toxin-antitoxin systems contribute to the maintenance of mobile genetic elements in Clostridioides difficile. Communications Biology 3(1):718. [PubMed:33247281]