Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1433950..1434155 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA03823 | ||
Toxin (Protein)
| Gene name | CD1233.1 | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 1433950..1434102 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ808 | ||
| Locus tag | - | ||
| Coordinates | 1434082..1434155 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS06835 | 1429412..1429696 | - | 285 | WP_003419254.1 | sigma-70 family RNA polymerase sigma factor | - |
| CD630_RS06840 (CD630_12310) | 1429719..1431236 | - | 1518 | WP_011861147.1 | recombinase family protein | - |
| CD630_RS06845 (CD630_12320) | 1431361..1432182 | - | 822 | WP_009896138.1 | tetratricopeptide repeat protein | - |
| CD630_RS06850 (CD630_12330) | 1432373..1433800 | + | 1428 | WP_011861148.1 | cell wall-binding protein Cwp26 | - |
| - | 1433950..1434102 | + | 153 | - | - | Toxin |
| - | 1434082..1434155 | - | 74 | - | - | Antitoxin |
| CD630_RS06855 (CD630_12333) | 1436823..1436978 | + | 156 | WP_003438173.1 | hypothetical protein | - |
| CD630_RS06860 (CD630_12340) | 1437224..1437475 | + | 252 | WP_003419270.1 | hypothetical protein | - |
| CD630_RS06865 (CD630_12350) | 1438696..1439079 | - | 384 | WP_011861151.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5811.96 Da Isoelectric Point: 11.1039
>T10175 - NC_009089:1433950-1434102 [Clostridioides difficile 630]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
Download Length: 153 bp
>T10175 NC_009089:1433950-1434102 [Clostridioides difficile 630]
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
Antitoxin
Download Length: 74 bp
>AT10175 NC_009089:c1434155-1434082 [Clostridioides difficile 630]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10176 | Clostridium difficile 630 |
68 |
100 |
0.68 |
| T10174 | Clostridium difficile 630 |
64 |
100 |
0.64 |
| T10081 | Clostridium difficile 630 |
48 |
100 |
0.511 |
| T10171 | Clostridium difficile 630 |
52.083 |
96 |
0.5 |
| T10080 | Clostridium difficile 630 |
46 |
100 |
0.489 |
| T10172 | Clostridium difficile 630 |
53.333 |
90 |
0.48 |
| T10173 | Clostridium difficile 630 |
53.333 |
90 |
0.48 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Anna Maikova et al. (2018) Discovery of new type I toxin-antitoxin systems adjacent to CRISPR arrays in Clostridium difficile. Nucleic Acids Research 46(9):4733-4751. [PubMed:29529286]