Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 3398302..3398516 | Replicon | chromosome |
| Accession | NC_009089 | ||
| Organism | Clostridium difficile 630 | ||
| T1TAdb ID | TA03827 | ||
Toxin (Protein)
| Gene name | CD2907.1 | Uniprot ID | Q183Z5 |
| Locus tag | CD630_RS19840 | Protein ID | WP_003429855.1 |
| Coordinates | 3398355..3398516 (-) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | RCd9 | ||
| Locus tag | - | ||
| Coordinates | 3398302..3398435 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS15515 (CD630_29060) | 3395518..3396087 | - | 570 | WP_011861035.1 | zinc-ribbon domain-containing protein | - |
| CD630_RS15520 (CD630_29070) | 3396131..3396691 | - | 561 | WP_011861034.1 | lipoprotein | - |
| - | 3398302..3398435 | + | 134 | - | - | Antitoxin |
| CD630_RS19840 (CD630_29071) | 3398355..3398516 | - | 162 | WP_003429855.1 | hypothetical protein | Toxin |
| CD630_RS15530 (CD630_29080) | 3398857..3399297 | - | 441 | WP_003429853.1 | phage portal protein | - |
| CD630_RS15535 (CD630_29090) | 3399369..3399839 | - | 471 | WP_003429851.1 | phage tail tube protein | - |
| CD630_RS15540 (CD630_29100) | 3399856..3401166 | - | 1311 | WP_011861032.1 | phage tail sheath family protein | - |
| CD630_RS19845 (CD630_29101) | 3401168..3401344 | - | 177 | WP_011861031.1 | hypothetical protein | - |
| CD630_RS15545 (CD630_29110) | 3401337..3401774 | - | 438 | WP_009901504.1 | hypothetical protein | - |
| CD630_RS15550 (CD630_29120) | 3401767..3402192 | - | 426 | WP_011861030.1 | HK97 gp10 family phage protein | - |
| CD630_RS15555 (CD630_29130) | 3402192..3402539 | - | 348 | WP_003429844.1 | hypothetical protein | - |
| CD630_RS15560 (CD630_29140) | 3402533..3402934 | - | 402 | WP_009888836.1 | hypothetical protein | - |
| CD630_RS15565 (CD630_29150) | 3402944..3403177 | - | 234 | WP_009896624.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3375898..3428859 | 52961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T10172 WP_003429855.1 NC_009089:c3398516-3398355 [Clostridioides difficile 630]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
>T10172 NC_009089:c3398516-3398355 [Clostridioides difficile 630]
ATGAATAACTTTTTACTTAATGTAATAGCTGGCGTTATTGCTAGTTTAATATTTTGCTTAATTTGTAAAGTATTTCTAAA
AGTAAAAAGCCACTCAACTCGTGGCAAGAGTAAAAGTGGCTGGGAATTTGATTTTAAAATCAAGTTCCATAAGTTCAAAT
AG
ATGAATAACTTTTTACTTAATGTAATAGCTGGCGTTATTGCTAGTTTAATATTTTGCTTAATTTGTAAAGTATTTCTAAA
AGTAAAAAGCCACTCAACTCGTGGCAAGAGTAAAAGTGGCTGGGAATTTGATTTTAAAATCAAGTTCCATAAGTTCAAAT
AG
Antitoxin
Download Length: 134 bp
>AT10172 NC_009089:3398302-3398435 [Clostridioides difficile 630]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10173 | Clostridium difficile 630 |
100 |
100 |
1 |
| T10174 | Clostridium difficile 630 |
52.83 |
100 |
0.56 |
| T10176 | Clostridium difficile 630 |
50.943 |
100 |
0.54 |
| T10081 | Clostridium difficile 630 |
49.02 |
100 |
0.532 |
| T10080 | Clostridium difficile 630 |
47.059 |
100 |
0.511 |
| T10171 | Clostridium difficile 630 |
49.057 |
100 |
0.5 |
| T10175 | Clostridium difficile 630 |
53.333 |
90 |
0.48 |
| T10083 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10084 | Clostridium difficile 630 |
35.135 |
100 |
0.382 |
| T10082 | Clostridium difficile 630 |
32.353 |
97.143 |
0.314 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Anna Maikova et al. (2018) Discovery of new type I toxin-antitoxin systems adjacent to CRISPR arrays in Clostridium difficile. Nucleic Acids Research 46(9):4733-4751. [PubMed:29529286]