Detailed information of TA system TA010173

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): CD-RCd/-
• Location: 1124125..1124339
• Replicon: chromosome
• Accession: NC_009089
• Organism: Clostridium difficile 630
• T1TAdb ID: TA03822

Toxin (Protein)

• Gene name: CD0956.2
• Uniprot ID: Q183Z5
• Locus tag: CD630_RS19695
• Protein ID: WP_003429855.1
• Coordinates: 1124125..1124286 (+)
• Length: 54 a.a.

Antitoxin (RNA)

Gene name	RCd10
Locus tag	-
Coordinates	1124206..1124339 (-)

Genomic Context

Location: 1119464..1119697 (234 bp)
Type: Others
Protein ID: WP_009896624.1

Location: 1119707..1120108 (402 bp)
Type: Others
Protein ID: WP_009888836.1

Location: 1120102..1120449 (348 bp)
Type: Others
Protein ID: WP_003429844.1

Location: 1120449..1120874 (426 bp)
Type: Others
Protein ID: WP_011861030.1

Location: 1120867..1121304 (438 bp)
Type: Others
Protein ID: WP_009901504.1

Location: 1121297..1121473 (177 bp)
Type: Others
Protein ID: WP_011861031.1

Location: 1121475..1122785 (1311 bp)
Type: Others
Protein ID: WP_011861032.1

Location: 1122802..1123272 (471 bp)
Type: Others
Protein ID: WP_003429851.1

Location: 1123344..1123784 (441 bp)
Type: Others
Protein ID: WP_003429853.1

Location: 1124125..1124286 (162 bp)
Type: Toxin
Protein ID: WP_003429855.1

Location: 1125950..1126510 (561 bp)
Type: Others
Protein ID: WP_011861034.1

Location: 1126554..1127123 (570 bp)
Type: Others
Protein ID: WP_011861035.1

Location: 1124206..1124339 (134 bp)
Type: Antitoxin
Protein ID: -

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CD630_RS05340 (CD630_09490)	1119464..1119697	+	234	WP_009896624.1	hypothetical protein	-
CD630_RS05345 (CD630_09500)	1119707..1120108	+	402	WP_009888836.1	hypothetical protein	-
CD630_RS05350 (CD630_09510)	1120102..1120449	+	348	WP_003429844.1	hypothetical protein	-
CD630_RS05355 (CD630_09520)	1120449..1120874	+	426	WP_011861030.1	HK97 gp10 family phage protein	-
CD630_RS05360 (CD630_09530)	1120867..1121304	+	438	WP_009901504.1	hypothetical protein	-
CD630_RS19690 (CD630_09531)	1121297..1121473	+	177	WP_011861031.1	hypothetical protein	-
CD630_RS05365 (CD630_09540)	1121475..1122785	+	1311	WP_011861032.1	phage tail sheath family protein	-
CD630_RS05370 (CD630_09550)	1122802..1123272	+	471	WP_003429851.1	phage tail tube protein	-
CD630_RS05375 (CD630_09560)	1123344..1123784	+	441	WP_003429853.1	phage portal protein	-
CD630_RS19695 (CD630_09562)	1124125..1124286	+	162	WP_003429855.1	hypothetical protein	Toxin
-	1124206..1124339	-	134	-	-	Antitoxin
CD630_RS05385 (CD630_09570)	1125950..1126510	+	561	WP_011861034.1	lipoprotein	-
CD630_RS05390 (CD630_09580)	1126554..1127123	+	570	WP_011861035.1	zinc-ribbon domain-containing protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NZ_CP010905 Clostridioides difficile 630 Prophage TA053077, TA053081 1056256..1128312 0.003 View NZ_CP016318 Clostridioides difficile strain 630 delta erm Prophage TA064399, TA064403 1076912..1148967 0.003 View NZ_LN614756 Clostridioides difficile strain 630Derm Prophage TA285464, TA285467 1076912..1148967 0.003	inside	Prophage	-	-	1078053..1143688	65635

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 54 a.a.
• Molecular weight: 6120.42 Da
• Isoelectric Point: 10.8938

>T10173 WP_003429855.1 NC_009089:1124125-1124286 [Clostridioides difficile 630]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK

Nucleotide

• Length: 162 bp

>T10173 NC_009089:1124125-1124286 [Clostridioides difficile 630]
ATGAATAACTTTTTACTTAATGTAATAGCTGGCGTTATTGCTAGTTTAATATTTTGCTTAATTTGTAAAGTATTTCTAAA
AGTAAAAAGCCACTCAACTCGTGGCAAGAGTAAAAGTGGCTGGGAATTTGATTTTAAAATCAAGTTCCATAAGTTCAAAT
AG

Antitoxin

Nucleotide

• Length: 134 bp

>AT10173 NC_009089:c1124339-1124206 [Clostridioides difficile 630]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10172	Clostridium difficile 630	100	100	1
T10174	Clostridium difficile 630	52.83	100	0.56
T10176	Clostridium difficile 630	50.943	100	0.54
T10081	Clostridium difficile 630	49.02	100	0.532
T10080	Clostridium difficile 630	47.059	100	0.511
T10171	Clostridium difficile 630	49.057	100	0.5
T10175	Clostridium difficile 630	53.333	90	0.48
T10084	Clostridium difficile 630	35.135	100	0.382
T10083	Clostridium difficile 630	35.135	100	0.382
T10082	Clostridium difficile 630	32.353	97.143	0.314

Showing 1 to 10 of 10 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A069AVN2

Antitoxin

References

(1) Anna Maikova et al. (2018) Discovery of new type I toxin-antitoxin systems adjacent to CRISPR arrays in Clostridium difficile. Nucleic Acids Research 46(9):4733-4751. [PubMed:29529286]


 experimental literature