Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1129404..1129618 | Replicon | chromosome |
Accession | NZ_LN614756 | ||
Organism | Clostridioides difficile strain 630Derm |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | CD630DERM_RS20890 | Protein ID | WP_003429855.1 |
Coordinates | 1129404..1129565 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1129485..1129618 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD630DERM_RS05450 | 1124743..1124976 | + | 234 | WP_009896624.1 | hypothetical protein | - |
CD630DERM_RS05455 | 1124986..1125387 | + | 402 | WP_009888836.1 | hypothetical protein | - |
CD630DERM_RS05460 | 1125381..1125728 | + | 348 | WP_003429844.1 | hypothetical protein | - |
CD630DERM_RS05465 | 1125728..1126153 | + | 426 | WP_011861030.1 | HK97 gp10 family phage protein | - |
CD630DERM_RS05470 | 1126146..1126583 | + | 438 | WP_009901504.1 | hypothetical protein | - |
CD630DERM_RS20885 | 1126576..1126752 | + | 177 | WP_011861031.1 | hypothetical protein | - |
CD630DERM_RS05480 | 1126754..1128064 | + | 1311 | WP_011861032.1 | phage tail sheath family protein | - |
CD630DERM_RS05485 | 1128081..1128551 | + | 471 | WP_003429851.1 | phage tail tube protein | - |
CD630DERM_RS05490 | 1128623..1129063 | + | 441 | WP_003429853.1 | phage portal protein | - |
CD630DERM_RS20890 | 1129404..1129565 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
- | 1129485..1129618 | - | 134 | NuclAT_5 | - | Antitoxin |
- | 1129485..1129618 | - | 134 | NuclAT_7 | - | Antitoxin |
- | 1129963..1130068 | - | 106 | NuclAT_11 | - | - |
- | 1129963..1130068 | - | 106 | NuclAT_13 | - | - |
CD630DERM_RS05500 | 1131229..1131789 | + | 561 | WP_011861034.1 | lipoprotein | - |
CD630DERM_RS05505 | 1131833..1132402 | + | 570 | WP_011861035.1 | zinc-ribbon domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1076912..1148967 | 72055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T285464 WP_003429855.1 NZ_LN614756:1129404-1129565 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 134 bp
>AT285464 NZ_LN614756:c1129618-1129485 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|