Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2418065..2418267 | Replicon | chromosome |
Accession | NZ_CP025046 | ||
Organism | Clostridioides difficile strain W0022a |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CWR55_RS11515 | Protein ID | WP_004454589.1 |
Coordinates | 2418115..2418267 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2418065..2418194 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CWR55_RS11480 | 2413314..2413631 | + | 318 | WP_009897465.1 | hypothetical protein | - |
CWR55_RS11485 | 2413767..2414231 | + | 465 | WP_004454576.1 | hypothetical protein | - |
CWR55_RS11495 | 2414560..2414721 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CWR55_RS19840 | 2414773..2415587 | - | 815 | Protein_2173 | toxin Bro | - |
CWR55_RS19845 | 2415707..2415859 | - | 153 | WP_009897477.1 | hypothetical protein | - |
CWR55_RS11510 | 2416998..2417921 | - | 924 | WP_021364626.1 | SHOCT domain-containing protein | - |
- | 2418065..2418194 | + | 130 | NuclAT_5 | - | Antitoxin |
CWR55_RS11515 | 2418115..2418267 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CWR55_RS11520 | 2418541..2418864 | - | 324 | WP_021364628.1 | hypothetical protein | - |
CWR55_RS11525 | 2418900..2419154 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CWR55_RS11535 | 2419586..2420104 | - | 519 | Protein_2179 | transposase | - |
CWR55_RS11540 | 2420394..2420768 | - | 375 | Protein_2180 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR55_RS11545 | 2420873..2421250 | - | 378 | WP_021364350.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR55_RS11550 | 2422055..2422549 | + | 495 | WP_021364347.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CWR55_RS19760 | 2422938..2423108 | + | 171 | WP_021416406.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2411493..2428357 | 16864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T89606 WP_004454589.1 NZ_CP025046:c2418267-2418115 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T89606 NZ_CP025046:c2418267-2418115 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT89606 NZ_CP025046:2418065-2418194 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|