Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2543142..2543344 | Replicon | chromosome |
Accession | NZ_CP011847 | ||
Organism | Clostridioides difficile strain DSM 27639 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF27639_RS12245 | Protein ID | WP_004454589.1 |
Coordinates | 2543192..2543344 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2543142..2543271 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF27639_RS12215 | 2538576..2539040 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CDIF27639_RS12225 | 2539368..2539529 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF27639_RS12230 | 2539581..2540394 | - | 814 | Protein_2257 | toxin Bro | - |
CDIF27639_RS20200 | 2540514..2540666 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CDIF27639_RS12240 | 2542075..2542998 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
- | 2543142..2543271 | + | 130 | NuclAT_3 | - | Antitoxin |
CDIF27639_RS12245 | 2543192..2543344 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF27639_RS12250 | 2543618..2543941 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF27639_RS12255 | 2543977..2544231 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF27639_RS12265 | 2544667..2545185 | - | 519 | Protein_2263 | transposase | - |
CDIF27639_RS12270 | 2545475..2545850 | - | 376 | Protein_2264 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF27639_RS12275 | 2545955..2546332 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF27639_RS12280 | 2547136..2547630 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF27639_RS12285 | 2548019..2548189 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2536302..2553438 | 17136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T55097 WP_004454589.1 NZ_CP011847:c2543344-2543192 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T55097 NZ_CP011847:c2543344-2543192 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT55097 NZ_CP011847:2543142-2543271 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|