Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3784904..3785106 | Replicon | chromosome |
Accession | NZ_CP020424 | ||
Organism | Clostridioides difficile strain FDAARGOS_267 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | A6J95_RS17675 | Protein ID | WP_004454589.1 |
Coordinates | 3784904..3785056 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 3784977..3785106 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6J95_RS20275 | 3780074..3780244 | - | 171 | WP_021394397.1 | hypothetical protein | - |
A6J95_RS17640 | 3780633..3781121 | - | 489 | WP_009897487.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
A6J95_RS17645 | 3781925..3782299 | + | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
A6J95_RS17650 | 3782404..3782777 | + | 374 | Protein_3330 | BlaI/MecI/CopY family transcriptional regulator | - |
A6J95_RS17655 | 3783067..3783585 | + | 519 | Protein_3331 | transposase | - |
A6J95_RS17665 | 3784017..3784271 | + | 255 | WP_004454592.1 | hypothetical protein | - |
A6J95_RS17670 | 3784307..3784630 | + | 324 | WP_009897482.1 | hypothetical protein | - |
A6J95_RS17675 | 3784904..3785056 | + | 153 | WP_004454589.1 | hypothetical protein | Toxin |
- | 3784977..3785106 | - | 130 | NuclAT_3 | - | Antitoxin |
A6J95_RS17680 | 3785250..3786134 | + | 885 | WP_009897481.1 | hypothetical protein | - |
A6J95_RS20415 | 3787117..3787269 | + | 153 | WP_009897477.1 | hypothetical protein | - |
A6J95_RS20420 | 3787389..3788203 | + | 815 | Protein_3337 | toxin Bro | - |
A6J95_RS17695 | 3788255..3788416 | + | 162 | WP_004454578.1 | hypothetical protein | - |
A6J95_RS17705 | 3788744..3789208 | - | 465 | WP_009897467.1 | hypothetical protein | - |
A6J95_RS17710 | 3789344..3789661 | - | 318 | WP_009897465.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3774825..3791482 | 16657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T74675 WP_004454589.1 NZ_CP020424:3784904-3785056 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T74675 NZ_CP020424:3784904-3785056 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT74675 NZ_CP020424:c3785106-3784977 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|